NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090259

Metagenome Family F090259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090259
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 74 residues
Representative Sequence MKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDKSFLKFLELADAS
Number of Associated Samples 72
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.41 %
% of genes near scaffold ends (potentially truncated) 15.74 %
% of genes from short scaffolds (< 2000 bps) 75.93 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.074 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(42.593 % of family members)
Environment Ontology (ENVO) Unclassified
(76.852 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.519 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.83%    β-sheet: 31.68%    Coil/Unstructured: 51.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.34.1.2: C-terminal domain of transcriptional repressorsd6e55a16e550.63
b.34.9.0: Tudor/PWWP/MBTd2l89a_2l890.59
e.80.1.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domaind4ogca44ogc0.58
d.3.1.3: Cysteine proteinasesd1tl9a_1tl90.57
b.34.11.0: Prokaryotic SH3-related domaind2hbwa12hbw0.57

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF05728UPF0227 2.78
PF01541GIY-YIG 1.85
PF11753DUF3310 0.93
PF07728AAA_5 0.93
PF00293NUDIX 0.93
PF09834DUF2061 0.93
PF00691OmpA 0.93
PF03332PMM 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002242|KVWGV2_10844356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69727Open in IMG/M
3300002514|JGI25133J35611_10004135Not Available7117Open in IMG/M
3300002514|JGI25133J35611_10046116All Organisms → Viruses → Predicted Viral1504Open in IMG/M
3300002519|JGI25130J35507_1014186Not Available1942Open in IMG/M
3300002519|JGI25130J35507_1046753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69872Open in IMG/M
3300003147|Ga0052235_1014797All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300006735|Ga0098038_1066832All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691277Open in IMG/M
3300006735|Ga0098038_1079958All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300006736|Ga0098033_1031490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1606Open in IMG/M
3300006736|Ga0098033_1039260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691413Open in IMG/M
3300006736|Ga0098033_1170261All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69607Open in IMG/M
3300006737|Ga0098037_1149993All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69783Open in IMG/M
3300006738|Ga0098035_1196879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69673Open in IMG/M
3300006750|Ga0098058_1190760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69535Open in IMG/M
3300006751|Ga0098040_1099604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69876Open in IMG/M
3300006751|Ga0098040_1199101All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69585Open in IMG/M
3300006753|Ga0098039_1008372Not Available3852Open in IMG/M
3300006789|Ga0098054_1212743All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69703Open in IMG/M
3300006790|Ga0098074_1118238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69693Open in IMG/M
3300006793|Ga0098055_1115489All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691044Open in IMG/M
3300006928|Ga0098041_1232921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69588Open in IMG/M
3300006929|Ga0098036_1167257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69670Open in IMG/M
3300006929|Ga0098036_1194762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69616Open in IMG/M
3300007963|Ga0110931_1053395All Organisms → Viruses → Predicted Viral1220Open in IMG/M
3300008050|Ga0098052_1195393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69788Open in IMG/M
3300008952|Ga0115651_1042121All Organisms → Viruses → Predicted Viral3759Open in IMG/M
3300009481|Ga0114932_10476600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69736Open in IMG/M
3300009593|Ga0115011_10011916All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5789Open in IMG/M
3300009593|Ga0115011_10263506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691297Open in IMG/M
3300009593|Ga0115011_11716676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69563Open in IMG/M
3300009790|Ga0115012_11040410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69679Open in IMG/M
3300010150|Ga0098056_1223064Not Available627Open in IMG/M
3300010150|Ga0098056_1283393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69547Open in IMG/M
3300011013|Ga0114934_10157862All Organisms → Viruses → Predicted Viral1068Open in IMG/M
3300012928|Ga0163110_10140517All Organisms → Viruses → Predicted Viral1662Open in IMG/M
3300012950|Ga0163108_10095019All Organisms → Viruses → Predicted Viral1897Open in IMG/M
3300012952|Ga0163180_10098146All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300012953|Ga0163179_10000731All Organisms → cellular organisms → Bacteria23362Open in IMG/M
3300012953|Ga0163179_10001118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria19069Open in IMG/M
3300012953|Ga0163179_10019454All Organisms → Viruses → Predicted Viral4488Open in IMG/M
3300012953|Ga0163179_10189951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691565Open in IMG/M
3300013115|Ga0171651_1015476All Organisms → Viruses → Predicted Viral2774Open in IMG/M
3300017702|Ga0181374_1003145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium3143Open in IMG/M
3300017704|Ga0181371_1066930All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69582Open in IMG/M
3300017718|Ga0181375_1072095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69564Open in IMG/M
3300017720|Ga0181383_1002257All Organisms → cellular organisms → Bacteria → Proteobacteria5473Open in IMG/M
3300017764|Ga0181385_1002335All Organisms → cellular organisms → Bacteria → Proteobacteria6605Open in IMG/M
3300017764|Ga0181385_1043038All Organisms → Viruses → Predicted Viral1413Open in IMG/M
3300017764|Ga0181385_1079556All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300017764|Ga0181385_1168337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69663Open in IMG/M
3300017768|Ga0187220_1227133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69560Open in IMG/M
3300020380|Ga0211498_10252657All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69666Open in IMG/M
3300020394|Ga0211497_10002229All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria12843Open in IMG/M
3300020395|Ga0211705_10151923All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69846Open in IMG/M
3300020403|Ga0211532_10073086All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300020403|Ga0211532_10073817All Organisms → Viruses → Predicted Viral1522Open in IMG/M
3300020410|Ga0211699_10066100Not Available1337Open in IMG/M
3300020410|Ga0211699_10303069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69623Open in IMG/M
3300020411|Ga0211587_10000291Not Available35098Open in IMG/M
3300020411|Ga0211587_10387856Not Available567Open in IMG/M
3300020411|Ga0211587_10403712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69554Open in IMG/M
3300020413|Ga0211516_10204577All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69906Open in IMG/M
3300020413|Ga0211516_10276263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69758Open in IMG/M
3300020428|Ga0211521_10000742Not Available27659Open in IMG/M
3300020428|Ga0211521_10012246All Organisms → cellular organisms → Bacteria → Proteobacteria5261Open in IMG/M
3300020430|Ga0211622_10000435All Organisms → cellular organisms → Bacteria48739Open in IMG/M
3300020430|Ga0211622_10018159All Organisms → Viruses → Predicted Viral3466Open in IMG/M
3300020430|Ga0211622_10030823Not Available2482Open in IMG/M
3300020430|Ga0211622_10059566All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1681Open in IMG/M
3300020462|Ga0211546_10587223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69561Open in IMG/M
3300020470|Ga0211543_10075217All Organisms → Viruses → Predicted Viral1748Open in IMG/M
3300020470|Ga0211543_10156213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691143Open in IMG/M
3300020471|Ga0211614_10005270All Organisms → cellular organisms → Bacteria → Proteobacteria5448Open in IMG/M
3300020471|Ga0211614_10094074All Organisms → Viruses → Predicted Viral1268Open in IMG/M
3300020473|Ga0211625_10036656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED693167Open in IMG/M
3300020473|Ga0211625_10041533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED692915Open in IMG/M
3300020474|Ga0211547_10200204All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300020477|Ga0211585_10247531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691096Open in IMG/M
3300020478|Ga0211503_10426283All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69708Open in IMG/M
3300020595|Ga0206126_10510282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69516Open in IMG/M
3300021379|Ga0213864_10077559All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691625Open in IMG/M
3300025078|Ga0208668_1005904All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED692838Open in IMG/M
3300025082|Ga0208156_1084383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium589Open in IMG/M
3300025096|Ga0208011_1017139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691905Open in IMG/M
3300025102|Ga0208666_1026850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691773Open in IMG/M
3300025112|Ga0209349_1019122All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2451Open in IMG/M
3300025122|Ga0209434_1046545All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691355Open in IMG/M
3300025131|Ga0209128_1069448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691216Open in IMG/M
3300025131|Ga0209128_1076834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1132Open in IMG/M
3300025132|Ga0209232_1067324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691267Open in IMG/M
3300025151|Ga0209645_1107100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69900Open in IMG/M
3300025151|Ga0209645_1209612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69569Open in IMG/M
3300025873|Ga0209757_10104295All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300026134|Ga0208815_1026995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69745Open in IMG/M
3300027906|Ga0209404_10001407Not Available16204Open in IMG/M
3300027906|Ga0209404_10541719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69774Open in IMG/M
3300028018|Ga0256381_1057452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69588Open in IMG/M
3300028022|Ga0256382_1073146All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300029319|Ga0183748_1022217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2218Open in IMG/M
3300029319|Ga0183748_1027485Not Available1894Open in IMG/M
3300029319|Ga0183748_1044175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1314Open in IMG/M
3300029319|Ga0183748_1045448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691284Open in IMG/M
3300029319|Ga0183748_1100471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69665Open in IMG/M
3300029787|Ga0183757_1003525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium5704Open in IMG/M
3300031773|Ga0315332_10626517All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69667Open in IMG/M
3300032011|Ga0315316_10437434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED691098Open in IMG/M
3300032073|Ga0315315_10637124Not Available981Open in IMG/M
3300032073|Ga0315315_10655081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium TMED69966Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine42.59%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine31.48%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.63%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.70%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.85%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.85%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.93%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300003147Planktonic microbial communities from North Pacific Subtropical GyreEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020395Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020411Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020473Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020477Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300026134Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028018Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600mEnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KVWGV2_1084435623300002242Marine SedimentMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDQSMLKFLELADASVP*
JGI25133J35611_10004135163300002514MarineMKIGELYEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLACVDGEESPAGPY*
JGI25133J35611_1004611633300002514MarineVKVGDLYEVHHKWLLPHSTSDFWSSCGSVLYLGEDTIHRDDGVTITNHAVLVDGQRRILDKSFLRFLEPIDESR*
JGI25130J35507_101418613300002519MarineMKIGELYEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLACVDGEESPA
JGI25130J35507_104675323300002519MarineMKVGELYEVRHRWMLPRSRANFWEDCGLVLYLGEEGLIREDGIKIVNHAVFVKGQRVIIDKTMLKFLELADAS*
Ga0052235_101479773300003147MarineVKVGKLYEVRHKWLLPHDNREFWSNCGPILYLGEDVIERSDGEHIINHGVLACGEHRILDATFLRLLEPVDEGDQ*
Ga0098038_106683233300006735MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDSSFLKFLELADASVP*
Ga0098038_107995823300006735MarineMKVGELYEVRHKWLLPRSRANFWEDCGAVLYLGEEGLIRDDGTKIVNHVVFVKGRRVIIDQTMLKFLELADAS*
Ga0098033_103149083300006736MarineMKIGELYEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLAHVDGEESPAGPY*
Ga0098033_103926013300006736MarineMKVGELYEVRHRWMLPRSRANFWKDCGLVLYLGEEGLIREDGIKIVNHAVFVKGQRVIIDKTMLKFLELADAS*
Ga0098033_117026123300006736MarineMKVGDLYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDQSMLKFLEHADAS*
Ga0098037_114999333300006737MarineVQVGKLYEVRHKWLLPRSRANFWEDCGAVLYLGEEGLIRDDGTKIVNHVVFVKGRRVIIDQTMLKFLELADAS*
Ga0098035_119687923300006738MarineMKVGDLYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDQSMLKFLELADAS*
Ga0098058_119076023300006750MarineMKVGDLYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVIIDKSMLKFLELANASVP*
Ga0098040_109960433300006751MarineMKVGELYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIERHDGTKIVNHAVFVKGQRVILDKSMLKFLELADASVL*
Ga0098040_119910113300006751MarineMKVGDLYEVRHKWLLPHSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDQSMLKFLELADAS*
Ga0098039_1008372153300006753MarineMKIGELYEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLA
Ga0098054_121274313300006789MarineMKVGELYEVRHKWLLPHDRTNFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVIIDKSMLKFLELANASVP*
Ga0098074_111823823300006790MarineMIVGKLYEVRHKWLLPHSTRDFWSDCGPVLYLGEDVSERDDGARIVNHVVLVKGEKRLLDRTFLKFLKPLTTS*
Ga0098055_111548953300006793MarineMKVGDLYEVRHKWMLPRSSANFWEDCGAVLYLGEEGLIREDGIKIVNHAVFVKGQRVLLDQSMLKFLELADAS*
Ga0098041_123292133300006928MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTKIVNHAVFVKGQRVILDSSFLKFLEL
Ga0098036_116725713300006929MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASVP*
Ga0098036_119476233300006929MarineMKVGELYEVCHTWLLPHSTSDFWSSCGPVLYVGEDVIVNQDGATVVNHVVLAAGQWRVLDKSFLKFLEPIDGDR*
Ga0110931_105339553300007963MarineMKVGELYEVRHKWLLPISRANFWDDCGAVLYLGEDVIEREDGTKIVNHVVFVKGSRIILDQSMLKFLELADASVS*
Ga0098052_119539333300008050MarineMKVGELYEVRHKWLLPHDRTNFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVIIDKSMLKFLE
Ga0115651_1042121123300008952MarineMKVGELYTVRHKWMLPRSRANFWEDCGAVLYLGEEGLIREDGIKIVNHAVFVKGQRVILDQSMLKFLELADAS*
Ga0114932_1047660023300009481Deep SubsurfaceVKVGELYEVRHRWLLPRSSANFWEDCGPVLYLGEDVCYTQDGYKVVNHAVFVKGQRVILDQSMLKFLELADASVP*
Ga0115011_1001191683300009593MarineMKIGELYEIQHKWMLPYSASKFWLDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFLKFLEPLTKT*
Ga0115011_1026350643300009593MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTKIVNHAVFVKGQRVILDNSFLKFLELADASVS*
Ga0115011_1171667613300009593MarineNIYRVCHKWLLPHSRSEFWSNCGSVLYLGEDIIHRGDGVTVTNHAVLVDGQRRILDKSFLKFLKRFNNGN*
Ga0115012_1104041013300009790MarineMQVGELYEIRHKWLLPHSTRDFWSTCGPVLYLGEDVIEREDGARIVNHAVLVKGQRRILDGSFLKFLEPLTNTLQKNA*
Ga0098056_122306443300010150MarineGELYTVRHKWMLPRSSANFWEDCGAVLYLGEEGLIREDGIKIVNHAVFVKGQRVLLDQSMLKFLELADAS*
Ga0098056_128339323300010150MarineMKVGELYEVRHKWLLPHDRTNFWEDCGAVLYLGEDVIVREDGTRIVNHAVFVKGQRVIIDKSMLKFLELADAPVP*
Ga0114934_1015786243300011013Deep SubsurfaceMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASR*
Ga0163110_1014051753300012928Surface SeawaterMMKVGSLYEVRHKWLLPRSTSDFWSNCGSVLYLGEDIIHRDDGVTVVNHAVLVDGQRRILDKSFLKFLEPINENG*
Ga0163108_1009501923300012950SeawaterMIKGKLYEVRHNWLLPRDNHEFWSTCGPVLYLGEDVIEREDGVRIVNHAVLVKGQRRILDRTFLRFLEPLTNT*
Ga0163180_1009814673300012952SeawaterVKVGEIYEVKHKWLLPAGSSDFWSNCGPVLYLGEDIIDRTDGIKIINHVVFVDGETRILDKTFLKFLEVING*
Ga0163179_10000731453300012953SeawaterMEPSLAGREIVKIGKLYQVCHTWLLPHSSAEFWRNCGPVMYIGEDIIRREDGKEIINHAVLVDGKKRIIDRTFLKFLEPLDENG*
Ga0163179_10001118473300012953SeawaterMVKGKLYKVAHNWLLPHSTSGFWSSCGPVLYLGEDVIERDDGVRVVNHAVLVKGERRIVDSSFLKFFEPLTKA*
Ga0163179_10019454153300012953SeawaterMKIGELYEVRHNWLLPRGTNEFWSNCGPVLYLGEDVIERSDGVRIVNHAVLVKGQRRILDGSFLKFLEPLTKA*
Ga0163179_1018995143300012953SeawaterVKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASVP*
Ga0171651_101547613300013115MarineMKVGELYTVRHKWMLPRSRANFWEDCGAVLYLGEEGLIRDDGTKIVNHAVFVKGQRVIIDQTMLKFLE
Ga0181374_1003145123300017702MarineMKVGELYEVRHRWMLPRSRANFWKDCGLVLYLGEEGLIREDGIKIVNHAVFVKGQRVIIDKTMLKYLELADAS
Ga0181371_106693033300017704MarineMKVGDLYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIERHDGTKIVNHAVFVKGQRVILDKSMLKFLELA
Ga0181375_107209523300017718MarineMKVGDLYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVLLDQSMLKFLELADAS
Ga0181383_1002257143300017720SeawaterMQVGELYEIQHKWMLPYSTSKFWLDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFLKFLEPLTKT
Ga0181385_1002335223300017764SeawaterVEVGKLYRVCHRWLLPHGTADFWGNCGPVLYLGEDVLEGEDGSRIVNYAVFVKGQRRLLDRTFLKFLEPIDEKS
Ga0181385_104303813300017764SeawaterVQVGELYEIQHKWMLPYSTSKFWLDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFL
Ga0181385_107955643300017764SeawaterMQVGELYEIQHKWMLPYSTSKFWMDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFL
Ga0181385_116833713300017764SeawaterMMKVGNLYEVRHKWLLPRSTSDFWSSCGSVLYLGEDTIHRDDGVTITNHAVLVDGQRRILDKSFLRFLEPIDESR
Ga0187220_122713313300017768SeawaterVKVGELYEVKHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDKSFLKFLELADASVS
Ga0211498_1025265723300020380MarineVQVGELYEVRHKWMLPHSTREFWSTCGPVLYLGEDVIEREDGVRIVNHAVLVKGQRRILDRSFLKFLEPLTNTLQENA
Ga0211497_10002229333300020394MarineVQVGELYEVRHKWMLPHSTREFWSTCGPVLYLGEDVIEREDGVRIVNHAVLVKGERRILDRSFLKFLEPLTNTLQENA
Ga0211705_1015192323300020395MarineMKVGELYQVCHKWLLPHSLSDFWSSCGPVLYLGEDVIEREDGAKIVNHAVFVDGQRRLLDHTFLKFLEPINESR
Ga0211532_1007308633300020403MarineVEVGKLYRVCHRWLLPHTTADFWGNCGPVLYLGEDVIESDDGARIVNYAVFAKGQRRLLDRSFLKFLEPIDEK
Ga0211532_1007381733300020403MarineMKVGELYEVRHKWMLPHSTREFWSTCGPVLYLGEDVIEREDGLRIVNHAVLVKGERRILDRTFLKFLEPLTNTLQKNA
Ga0211699_1006610023300020410MarineVNVGELYEVRHTWLLPHSTSDFWSSCGPVLYIGEDVIVNQDGKKIVNYVVLAGGERRVLDQSFLKFLEPISCSDRKTGV
Ga0211699_1030306913300020410MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTKIVNHAVFVKGQRVILDKSFLKFLELADAS
Ga0211587_10000291143300020411MarineMVKGKLYKVAHNWLLPHSTSEFWSSCGPVLYLGEDVIERDDGVRVVNHAVLVKGERRIVDRSFLKFFEPLTKA
Ga0211587_1038785633300020411MarineVRHKWLLPRSTSDFWSDCGPVLYLGEDVCYTQDGYKVVNHAVFVKGQRRILDQSFLKFLEPADASG
Ga0211587_1040371213300020411MarineMKVGELYEVRHKWLLPKSRANFWEDCGAVLYLGEDVCYTQDGYKVVNHAVFVKGQRRILDQSFLKFLEPADASVS
Ga0211516_1020457713300020413MarineMKVGELYEVRHTWLLPHSTSDFWSSCGPVLYVGEDVFVNQDGKKIVNYVVLAGGERRTLDQSFLKFLEPISCSNRKAGV
Ga0211516_1027626333300020413MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASV
Ga0211521_10000742403300020428MarineVQVGELYEIQHKWMLPYSTSKFWSDCGPILYLGEDVIDREDGARIVNHAVLVKGQRRILDGSFLKFLEPLTKT
Ga0211521_1001224663300020428MarineMKPGELYAVKHKWLLPRSLSDFWSPVETVIYIGEDVIEREDGVKITNHVVLAEGQPRILDQTFLKFLEPVHENR
Ga0211622_10000435573300020430MarineVQVGKLYEVRHKWQLPFSTRKFWSNCGPVLYLGEDVIEREDGVKIVNHAVLANGQKRILDKSFLKFLEPLTSS
Ga0211622_10018159143300020430MarineVKVGELYEVRHNWLLPHSTRDFWSTCGPVLYLGEDVIEREDGAMIVNHAVLVKGQRRILDKSFLKFLEPLTKT
Ga0211622_1003082383300020430MarineMMKVGSLYEVRHKWLLPRSTSDFWSNCGSVLYLGEDIIRRDDGVTVVNHVVLVDGQRRILDKSFLKFLELINENG
Ga0211622_1005956663300020430MarineMKVGELYQVCHKWLLPHSLSDFWSSCGPVLYLGEDVIEREDGAKIVNHAVFVDGQHRILDHTFLKFLEPINESR
Ga0211546_1058722323300020462MarineVKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASVP
Ga0211543_1007521743300020470MarineVQVGELYEVRHKWMLPYSTSSFWLDCGPILYLGEDVIEREDGVRIVNHAVLVKGERRILDGSFLKFLEPLTKTLQKNA
Ga0211543_1015621333300020470MarineMKVGELYEVKHKWLLPISISDFWSDCGPVLYLGEEGLICEDGTKIVNHVVFVKGQRRILDQSFLKFLEPADASVL
Ga0211614_1000527083300020471MarineMNVGELYQVCHKWLLPHSTSDFWSNCGAVLYVGEDIFHREDGKTIVNHAVLVDGQRRVLDQSFLKFLEPIDESR
Ga0211614_1009407423300020471MarineMKVGELYEVKHKWLLPISISDFWSDCGPVLYLGEDVCYTQDGYKVVNHAVFVKGERRILDQSFLKFLELTDASG
Ga0211625_1003665653300020473MarineMQVGELYEVRHKWLLPRSRANFWEDCGAVLYLGEDVIERDDGTKIVNHVVFVKGQRVIIDQTMLKFLELADASVR
Ga0211625_1004153333300020473MarineMKVGELYEVRHKWLLPRSRANFWDDCGTVLYLGEDVIERDDGTKIVNHVVFVKGQRVILDQSMLKFLELADASG
Ga0211547_1020020413300020474MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADASVP
Ga0211585_1024753143300020477MarineMKVGELYEVRHKWMLPRSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDQSFLKFLELADAS
Ga0211503_1042628313300020478MarineMKVGELYEVRHKWLLPHSRANFWEDCGPVLYLGEDVIERDDGTRIVNHAVFVKGQRVILDKSMLKFLELADAAVP
Ga0206126_1051028223300020595SeawaterMKVGELYEVRHKWLLPISRANFWDDCGAVLYLGEDVIEREDGTKIVNHAVFVKGQRVILDNSFLKFLELADAPVP
Ga0213864_1007755923300021379SeawaterMIVGKLYEVRHKWLLPHSTRDFWSDCGPVLYLGEDVIERDDGARIVNHVVLVKGEKRLLDRTFLKFLKPLTTS
Ga0208668_100590483300025078MarineMKVGELYEVRHRWMLPRSRANFWKDCGLVLYLGEEGLIREDGIKIVNHAVFVKGQRVIIDKTMLKFLELADAS
Ga0208156_108438313300025082MarineEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLAHVDGEESPAGPY
Ga0208011_101713963300025096MarineMKVGELYEVRHKWMLPHSRANFWEDCGAVLYLGEDVIERHDGTKIVNHAVFVKGQRVILDKSMLKFLELADASVL
Ga0208666_102685023300025102MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDSSFLKFLELADASVP
Ga0209349_101912293300025112MarineMKIGELYEVRHKWLLPHDNYEFWSNCGPVLYVGEAIINRDDGKEIVNHVVLVNGKRRLLDSTFLRLLACVDGEESPAGPY
Ga0209434_104654533300025122MarineMKVGELYEVRHRWMLPRSRANFWEDCGLVLYLGEEGLIREDGIKIVNHAVFVKGQRVIIDKTMLKFLELADAS
Ga0209128_106944843300025131MarineVKVGDLYEVHHKWLLPHSTSDFWSSCGSVLYLGEDTIHRDDGVTITNHAVLVDGQRRILDKSFLRFLEPIDESR
Ga0209128_107683443300025131MarineMKPGRLYEIRHKWLLPHSTREFWSSCGPILYLCKDTIRRDDGKIIVNHRVLVKGEYRILDHTFLRLLEPSCESR
Ga0209232_106732433300025132MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDKSFLKFLELADAS
Ga0209645_110710023300025151MarineMKVGELYEVRHTWLLPHSTSDFWSSCGPVLYVGEDVIVNQDGKKIVNYVVLAGGERRVLDQSFLKFLEPISCSNRKAGV
Ga0209645_120961223300025151MarineMKVGELYEVRHNWLLPHSTRDFWSTCGPVLYLGEDVIEREDGARIVNHAVLVKGERRILDRTFLKFLEPLTKA
Ga0209757_1010429533300025873MarineVKVGKLYEVRHEWLLPHDNCEFLSSCGPILYLGEDVIERSDGKRIINHAVLARGKHHILDTTFLRLLEPINEGDQ
Ga0208815_102699513300026134Marine OceanicMKVGELYEVRHKWMLPRSRANFWEDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDSSFLKFLELADAS
Ga0209404_1000140723300027906MarineMKIGELYEIQHKWMLPYSASKFWLDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFLKFLEPLTKT
Ga0209404_1054171923300027906MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTKIVNHAVFVKGQRVILDNSFLKFLELADASVS
Ga0256381_105745213300028018SeawaterVKVGDLYEVRHKWLLPHDNREFWSSCGPILYLGEDVIDRSDGKSIVNHAVLAGGEHRLLDATFLRLLEPVDEGDP
Ga0256382_107314613300028022SeawaterMKVGELYEVRHKWLLPRSRANFWEDCGAVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDKSMLKFLELADAS
Ga0183748_102221743300029319MarineMIVGELYEVRPGVLTHHNFWSNCGPVLYLGEDAIDRKDGVRIIRIINHVVLVKGEKRLLDRTFLKFLKPLTSS
Ga0183748_102748533300029319MarineVNAGELYEVRHKWLLPHSTSDFWSSCGPVLYVGEDVIVNQDGAKVVNHVVLAAGQRRVLDKSFLKFLEPIDGDR
Ga0183748_104417553300029319MarineVKPGELYKVCHTWLLPHSTYDFWSSCGPVLYIGEEGLLREDGVKIVNHVVLVAGQRRVLDQSFLKFLEPIDESR
Ga0183748_104544833300029319MarineMKVGELYEVKHKWLLPISISDFWSDCGPVLYLGEEGLIREDGTKIVNHAVFVKGQRRLLDQSFLKFLEPADASVL
Ga0183748_110047123300029319MarineMKVGELYEVKHKWLLPISISDFWSDCGPVLYLGEEGLIREDGTKIVNHAVFVKGQRRLLDQSFLKFLEPADAS
Ga0183757_1003525113300029787MarineMKVGELYEVRHKWLLPISRANFWDDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVILDNSFLKFLELADAS
Ga0315332_1062651713300031773SeawaterMQVGELYEIQHKWMLPYSTSKFWMDCGPILYLGEDVIDREDGVRIVNHAVLVKGQRRILDGSFLKFLEPLTKT
Ga0315316_1043743443300032011SeawaterYEVRHKWLLPHSRANFWEDCGTVLYLGEDVIEREDGTRIVNHAVFVKGQRVIIDKSMLKFLELANASVP
Ga0315315_1063712413300032073SeawaterCHKWLLPRSTSDFWSSCGSVLYLGEDIIHREDGVTITNHAVLVDGQRRLLDKSFLKFLEPIDESR
Ga0315315_1065508143300032073SeawaterMMKVGNLYEVRHKWLLPRSTSDFWSICGSVLYLGKDTIHRDDGVTITNHAVLVDSQRRILDKSFLRFLEPTDESR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.