NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090473

Metagenome Family F090473

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090473
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 41 residues
Representative Sequence MELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDE
Number of Associated Samples 89
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.41 %
% of genes near scaffold ends (potentially truncated) 93.52 %
% of genes from short scaffolds (< 2000 bps) 92.59 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.593 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.482 % of family members)
Environment Ontology (ENVO) Unclassified
(42.593 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.926 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.59%    β-sheet: 0.00%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF09335SNARE_assoc 2.78
PF02239Cytochrom_D1 1.85
PF028262-Hacid_dh_C 1.85
PF00005ABC_tran 1.85
PF00528BPD_transp_1 1.85
PF00171Aldedh 1.85
PF03401TctC 0.93
PF04392ABC_sub_bind 0.93
PF01436NHL 0.93
PF01329Pterin_4a 0.93
PF04430DUF498 0.93
PF00903Glyoxalase 0.93
PF03601Cons_hypoth698 0.93
PF00486Trans_reg_C 0.93
PF07007LprI 0.93
PF01609DDE_Tnp_1 0.93
PF00211Guanylate_cyc 0.93
PF02129Peptidase_S15 0.93
PF00589Phage_integrase 0.93
PF00580UvrD-helicase 0.93
PF01135PCMT 0.93
PF00239Resolvase 0.93
PF13416SBP_bac_8 0.93
PF14534DUF4440 0.93
PF04073tRNA_edit 0.93
PF03006HlyIII 0.93
PF08530PepX_C 0.93
PF01425Amidase 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 2.78
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 2.78
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 2.78
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.85
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.85
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.85
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.93
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.93
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.93
COG1504Uncharacterized conserved protein, DUF498 domainFunction unknown [S] 0.93
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.93
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.93
COG2154Pterin-4a-carbinolamine dehydrataseCoenzyme transport and metabolism [H] 0.93
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.93
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.93
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.93
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.93
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.93
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.93
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.93
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.93
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.93
COG3293TransposaseMobilome: prophages, transposons [X] 0.93
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.93
COG3737Uncharacterized protein, contains Mth938-like domainFunction unknown [S] 0.93
COG3755Uncharacterized conserved protein YecT, DUF1311 familyFunction unknown [S] 0.93
COG3973DNA helicase IVReplication, recombination and repair [L] 0.93
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.93
COG5421TransposaseMobilome: prophages, transposons [X] 0.93
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.93
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.59 %
UnclassifiedrootN/A32.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005947|Ga0066794_10258380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300005980|Ga0066798_10127647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium722Open in IMG/M
3300006354|Ga0075021_10523515All Organisms → cellular organisms → Bacteria → Proteobacteria752Open in IMG/M
3300006854|Ga0075425_101991166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300009038|Ga0099829_10332489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1249Open in IMG/M
3300009089|Ga0099828_11948353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei515Open in IMG/M
3300009522|Ga0116218_1257957Not Available783Open in IMG/M
3300009632|Ga0116102_1186616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300009698|Ga0116216_10436887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium793Open in IMG/M
3300009760|Ga0116131_1079955All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300009792|Ga0126374_10637604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300010047|Ga0126382_11290371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300010048|Ga0126373_12953815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300010358|Ga0126370_11549164Not Available632Open in IMG/M
3300010360|Ga0126372_10347813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1328Open in IMG/M
3300010360|Ga0126372_11042967All Organisms → cellular organisms → Bacteria → Proteobacteria832Open in IMG/M
3300010361|Ga0126378_11328117Not Available813Open in IMG/M
3300010366|Ga0126379_12649196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300010366|Ga0126379_12868756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300010376|Ga0126381_103175049All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300010379|Ga0136449_102510746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300010379|Ga0136449_102995793Not Available660Open in IMG/M
3300010398|Ga0126383_13284524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300012202|Ga0137363_10090138Not Available2307Open in IMG/M
3300012205|Ga0137362_10335175Not Available1310Open in IMG/M
3300012207|Ga0137381_11030901Not Available709Open in IMG/M
3300012209|Ga0137379_11217850Not Available660Open in IMG/M
3300012210|Ga0137378_10126045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2365Open in IMG/M
3300012210|Ga0137378_10474540Not Available1157Open in IMG/M
3300012361|Ga0137360_11480531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300012951|Ga0164300_10921635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300012971|Ga0126369_11272715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300012971|Ga0126369_11750626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium710Open in IMG/M
3300012971|Ga0126369_11760215All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300012984|Ga0164309_11413181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300014054|Ga0120135_1092039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300014200|Ga0181526_10202475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB201270Open in IMG/M
3300014638|Ga0181536_10117992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1462Open in IMG/M
3300016319|Ga0182033_10230240All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300016341|Ga0182035_11320366Not Available646Open in IMG/M
3300016371|Ga0182034_11356707Not Available621Open in IMG/M
3300016371|Ga0182034_12072120Not Available502Open in IMG/M
3300016387|Ga0182040_10244895All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300016404|Ga0182037_10988594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria733Open in IMG/M
3300016445|Ga0182038_11242306Not Available665Open in IMG/M
3300017940|Ga0187853_10402310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300017961|Ga0187778_11238415Not Available524Open in IMG/M
3300017994|Ga0187822_10327823Not Available547Open in IMG/M
3300018008|Ga0187888_1022433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603283Open in IMG/M
3300021168|Ga0210406_10279474Not Available1363Open in IMG/M
3300021181|Ga0210388_10805264All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300021407|Ga0210383_10364646All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300021479|Ga0210410_11377389Not Available598Open in IMG/M
3300021560|Ga0126371_13892830All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025439|Ga0208323_1021676All Organisms → cellular organisms → Bacteria → Proteobacteria1377Open in IMG/M
3300025457|Ga0208850_1038427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300025457|Ga0208850_1054311Not Available662Open in IMG/M
3300025891|Ga0209585_10475727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300026498|Ga0257156_1136439Not Available511Open in IMG/M
3300027908|Ga0209006_10772240Not Available781Open in IMG/M
3300027910|Ga0209583_10407163Not Available649Open in IMG/M
3300028047|Ga0209526_10617517Not Available692Open in IMG/M
3300028819|Ga0307296_10370356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300031226|Ga0307497_10732593Not Available513Open in IMG/M
3300031546|Ga0318538_10459725All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300031546|Ga0318538_10525526All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031561|Ga0318528_10754193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300031572|Ga0318515_10046780All Organisms → cellular organisms → Bacteria → Proteobacteria2165Open in IMG/M
3300031573|Ga0310915_10941560Not Available604Open in IMG/M
3300031573|Ga0310915_10969238Not Available594Open in IMG/M
3300031679|Ga0318561_10018285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3213Open in IMG/M
3300031680|Ga0318574_10358795All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300031708|Ga0310686_112642128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1176Open in IMG/M
3300031708|Ga0310686_119089095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2695Open in IMG/M
3300031719|Ga0306917_11016242Not Available647Open in IMG/M
3300031724|Ga0318500_10254621Not Available852Open in IMG/M
3300031744|Ga0306918_11238511Not Available575Open in IMG/M
3300031747|Ga0318502_10885372Not Available542Open in IMG/M
3300031754|Ga0307475_10685582All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300031763|Ga0318537_10322601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300031768|Ga0318509_10775548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300031770|Ga0318521_10173517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1234Open in IMG/M
3300031770|Ga0318521_10198809All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300031798|Ga0318523_10577010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031835|Ga0318517_10012033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae3125Open in IMG/M
3300031845|Ga0318511_10416170Not Available617Open in IMG/M
3300031879|Ga0306919_10358718All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1114Open in IMG/M
3300031893|Ga0318536_10434888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300031942|Ga0310916_10013397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5565Open in IMG/M
3300031942|Ga0310916_11533620Not Available542Open in IMG/M
3300031942|Ga0310916_11573203All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031946|Ga0310910_10649188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium836Open in IMG/M
3300031954|Ga0306926_11063270All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300031954|Ga0306926_11786508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031954|Ga0306926_12526133All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031962|Ga0307479_10350159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1460Open in IMG/M
3300032001|Ga0306922_11573292Not Available655Open in IMG/M
3300032010|Ga0318569_10579554Not Available522Open in IMG/M
3300032042|Ga0318545_10082012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1118Open in IMG/M
3300032042|Ga0318545_10307137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300032059|Ga0318533_11247569Not Available543Open in IMG/M
3300032064|Ga0318510_10379417All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032090|Ga0318518_10456973All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300032261|Ga0306920_101849650All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. BH-1850Open in IMG/M
3300032261|Ga0306920_103347622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300032261|Ga0306920_103845742Not Available548Open in IMG/M
3300033289|Ga0310914_11291579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium632Open in IMG/M
3300033887|Ga0334790_145143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066794_1025838023300005947SoilMELNRPPLVVAFELSEKRKAIVADALAGASAVVYLTE
Ga0066798_1012764713300005980SoilMELNRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAAR
Ga0075021_1052351523300006354WatershedsMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDE
Ga0075425_10199116613300006854Populus RhizosphereMEFSRPPLVVAFELSEKRKAIAADALAGASDVVYLTELD
Ga0099829_1033248943300009038Vadose Zone SoilMELSRPPLVVAFELSEKRKAIVADALAGASTVVYLTEL
Ga0099828_1194835323300009089Vadose Zone SoilLHWTDAPLVIAFALSEKRKAIVAAALAGASAVVYLTE
Ga0116218_125795713300009522Peatlands SoilMELSRPPLVVAFELSEKRKAIVANALAGASAVAYLTELDDAARTRFRVN*
Ga0116102_118661613300009632PeatlandMDLSPLPLVVAFELSEKRKAIVADALAGASAVVYLTELD
Ga0116216_1043688723300009698Peatlands SoilMELSRPPLVVAFELNEKRKAIVADALAGASAVVYLVAAELHR*
Ga0116131_107995533300009760PeatlandMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAE
Ga0126374_1063760413300009792Tropical Forest SoilMEFSRPPLVIAFELSEPRKAIVADTLAGVSDVVYLTELDEAART
Ga0126382_1129037113300010047Tropical Forest SoilMELSRPPLVVAFELSERRKAIVADALAGASAVIYLTELDGAARAEALR
Ga0126373_1295381513300010048Tropical Forest SoilMEFSRPPLVVAFELSETRKAIVAETLAGVSAVVYLTELD
Ga0126370_1154916413300010358Tropical Forest SoilANLGGAMELNRPPLVITFELSDRRKAIVTDALAGASAVVYLTELDEAAR*
Ga0126372_1034781333300010360Tropical Forest SoilMEFSRPPLVIAFELSETRKAIVADTLAGASDVVYLTELDEAARAEALR
Ga0126372_1104296723300010360Tropical Forest SoilMEFSRPPLVVAFELSKKRKAIVADALAGASDVVCLTELDEAARA
Ga0126378_1132811733300010361Tropical Forest SoilMELSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDE
Ga0126379_1264919613300010366Tropical Forest SoilMEFSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDEAAR
Ga0126379_1286875613300010366Tropical Forest SoilMEFSRPPLVVAFELSEKRKAIVADALAGASDVVYLTEI
Ga0126381_10317504913300010376Tropical Forest SoilMDLSRPPLVVGFELSEKRKAIVADALAGASDVVYLT
Ga0136449_10251074613300010379Peatlands SoilMELSRPPLVVAFELGEKRKAIVADALAGVSAVVYLTELDEAARAE
Ga0136449_10299579323300010379Peatlands SoilMELSRSPLVVTFELSEKRKAIVADTLAGASAVVYLTELDEA*
Ga0126383_1328452423300010398Tropical Forest SoilMEFSRPPLVVAFELSEKRKAIVADALAGASDVVCLTELDEASRAEALR
Ga0137363_1009013843300012202Vadose Zone SoilMEFSRPPLVVAFELSEKRKAIVADTLAGVSAVVYLTELDE
Ga0137362_1033517523300012205Vadose Zone SoilMEFNRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDSVPSHA*
Ga0137381_1103090123300012207Vadose Zone SoilMELSRPPLVVAFELSEKRKAIVADAPVGASAVVYLTELDEAAHETDN*
Ga0137379_1121785013300012209Vadose Zone SoilMQLTRLPLVVAFELSEKRRTILTDALAGAAPVVYLTELDAAGRAEA
Ga0137378_1012604513300012210Vadose Zone SoilMELNRLPLVVTFELSEQRKAIVNDALAGATDVVYLTE
Ga0137378_1047454013300012210Vadose Zone SoilMEFSPPPLVIAFELSETRKAIVADTLAGASDVVYLTELDEAAR
Ga0137360_1148053123300012361Vadose Zone SoilMEFSPPPLVIAFELSETRKAIVADTLAGASDVVYLPELDEAARAEAL
Ga0164300_1092163523300012951SoilMELSRPPLVVAFELSERRKAIVADALAGASVVIYLTELDGTA
Ga0126369_1127271513300012971Tropical Forest SoilMELSRPPLVVAFEMSQKHKAIVADNLAGASDVVYL
Ga0126369_1175062623300012971Tropical Forest SoilMEFSRPPLVVAFELSEKRKAIVADTLAGASDVVYL
Ga0126369_1176021513300012971Tropical Forest SoilMEFSRPPLVIAFELSEKRKAIVADALAGASDVVYLTELD
Ga0164309_1141318123300012984SoilMELSRLPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAAR
Ga0120135_109203923300014054PermafrostMELVRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAEALCN
Ga0181526_1020247523300014200BogMKLSRSPLVVAFELSEKRKAIVADALAGAGAVVYLTELDEAARAEALR
Ga0181536_1011799213300014638BogMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDESDRAE
Ga0182033_1023024033300016319SoilDLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLGTG
Ga0182035_1132036613300016341SoilMRLNRPLLVVAFELSERRKVIVADALAGAARVVYLTE
Ga0182034_1135670723300016371SoilMALNRPPLVVAFELSEKRKAIVADALAGASAILYLTEVDEAARAE
Ga0182034_1207212013300016371SoilMELSQPPLVVAFEVSEKRKAIVAEALAGTSAVVYLTE
Ga0182040_1024489523300016387SoilMELSRPLVIAFALSQRRKAIVADALAGASAVVYLTELDETARA
Ga0182037_1098859433300016404SoilMELSRPLVVAFALSQKRKAIVADALAGASAVVYLTELDET
Ga0182038_1124230613300016445SoilMELSQPPLVVAFEVSEKRKAIVAEALAGTSAVVYLTELDHTARAEA
Ga0187853_1040231013300017940PeatlandMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELD
Ga0187778_1123841513300017961Tropical PeatlandMELNRPPLVVAFGLSEKRKAIVADALAGASAVVYLTELDQADRAEVLR
Ga0187822_1032782313300017994Freshwater SedimentMELSQPALVVAFALSQKRRAIAADALAGASAVVHLTELDETARTE
Ga0187888_102243353300018008PeatlandMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARAEALR
Ga0210406_1027947413300021168SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYL
Ga0210388_1080526433300021181SoilMELSGPLVVAFALSQKRKAIVADALAGASAVVYLTELGETARTEALR
Ga0210383_1036464613300021407SoilMGLSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARA
Ga0210410_1137738923300021479SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTEL
Ga0126371_1389283023300021560Tropical Forest SoilLNPPPLVVAFELSQRRKSIVADALAGASAIIYLAELDRAAR
Ga0208323_102167613300025439PeatlandMELSRPPLIVAFELSEKHKAIVAHALAGASAVVYLTELDEA
Ga0208850_103842713300025457Arctic Peat SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLT
Ga0208850_105431113300025457Arctic Peat SoilMELNRPPLVVAFELSEKRKAIVADALAGASAVVYLT
Ga0209585_1047572713300025891Arctic Peat SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLIEL
Ga0257156_113643913300026498SoilLGCMEFSRPPLVVAFELSEKRKAIVADTLAGVSAVVY
Ga0209006_1077224023300027908Forest SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEA
Ga0209583_1040716313300027910WatershedsMELSRPPLVVAFELSDRHKAIVADALSGASTVVYLTELDEAA
Ga0209526_1061751723300028047Forest SoilLSRPPLVVAFELSERRKAIVAGALAGASVVIYLTELDGTARAEAL
Ga0307296_1037035633300028819SoilMELSRPQLVVAFELSEKRNNKAIVADALAGASAVV
Ga0307497_1073259323300031226SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAARTEAL
Ga0318538_1045972513300031546SoilMEFSRPPLVIAFELSEKRKAIVADALAGASNVVYL
Ga0318538_1052552623300031546SoilMELSRPPLVVAFELSQKRKAIVADALAGASDVVYL
Ga0318528_1075419313300031561SoilLSRPPLVVAFGLSEKRKAIVADALAGASDVVCLTELD
Ga0318515_1004678013300031572SoilMEFSRPPLVVAFELSEPRKAIVADTLAGVSDVVYLTDLDEA
Ga0310915_1094156023300031573SoilMGLNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDEMARAEAL
Ga0310915_1096923813300031573SoilLNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDE
Ga0318561_1001828543300031679SoilMEFSRPPLVVAFGLSEKRKAIVADALAGASDVVCLTEL
Ga0318574_1035879513300031680SoilMDLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLGTG
Ga0310686_11264212853300031708SoilMELSRPPLVVAFKLSEKRKAIVADALAGASAVVYLT
Ga0310686_11908909513300031708SoilMELSRPPLVVTFELSEKRKAIVADALAGASAVVYLTELN
Ga0306917_1101624213300031719SoilMRLNRPLLVVAFELSERRKVIVADALAGAARVVYLTELDETARAE
Ga0318500_1025462113300031724SoilMELSRPLVIAFALSQRRKAIVADALAGASAVVYLTE
Ga0306918_1123851113300031744SoilMALKRPPLVVTFALSEKRKAIVADALAGASPVLYLTELDEA
Ga0318502_1088537223300031747SoilMEFSRPPLVIAFELSEKRKAIVADALAGASNVVYLTELDKAARAE
Ga0307475_1068558213300031754Hardwood Forest SoilMELSGPLVVAFALSQKRKAIVADALAGASAVVYLTELDET
Ga0318537_1032260113300031763SoilLSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDEAARAE
Ga0318509_1077554813300031768SoilMELSPPPLVVAFELSERRKSIVADGLAGASPIVCLAELDGTARVEALRS
Ga0318521_1017351723300031770SoilMEFSRPPLVIAFELSEKRKAIVADTLAGASDVVYLTDLDEA
Ga0318521_1019880913300031770SoilMDLSRPPLVVTFELSERRKVIVANALSGASTVVYLTKLD
Ga0318523_1057701013300031798SoilLGCMEFTRPPLVVAFELSEKRKAIVADALAGVSAVIYLTEID
Ga0318517_1001203333300031835SoilMEFSRPPLVVAFELSEPRKAIVADTLAGVSDVAYLTELDE
Ga0318511_1041617013300031845SoilLSRPSLVVAFELSERSKAIVADALAGASAVVYLTELRGTVRA
Ga0306919_1035871823300031879SoilMNLSRSPLVVTFKLSERRKAIVADVLAGASAVVYLTELDGAARAEVGRHT
Ga0318536_1043488813300031893SoilLGCMEFTRPPLVVAFELSEKRKAIVADALAGVSAVIYLTEIDDVARAE
Ga0310916_1001339763300031942SoilMLGYMEFSRPPLVVAFELSEKRKALVADTLAGASDVVLPHRPR
Ga0310916_1153362023300031942SoilMELSRPPLVVAFELSEKRKAIVADALAGTSAVVYLTELDEAAP
Ga0310916_1157320323300031942SoilMELSRPLVVAFALSQKHKAIVADALAGASAVVYLTELDETARTE
Ga0310910_1064918823300031946SoilMGLSRPSLVVAFELSERSKAIVADALAGASAVIYLTELRGTVRAE
Ga0306926_1106327023300031954SoilLSRPPLVVAFELSQKRKAIVADALAGASDVVYLTELDE
Ga0306926_1178650833300031954SoilMEFSRPPLVIAFELSETRKAIVADALAGVSAVVYLTELD
Ga0306926_1252613323300031954SoilMPAGPPLVVAFQLSEKRKPIVTAGLAGAAPVIYLTELDAAERAAA
Ga0307479_1035015913300031962Hardwood Forest SoilMELSRPPLVVAFALSPKRKAIVTDALAGASAVVYLTELDEMARTEALR
Ga0306922_1157329213300032001SoilMGLNRPLLVVAFELSERRKAIVADALAGAARVVYLTELD
Ga0318569_1057955413300032010SoilMEFSRPPLVIAFELSEPRKAIVADILAGVSDVVYL
Ga0318545_1008201223300032042SoilMDLSRPPLVIGFELSEKRKAIVADALAGAGAVVYLG
Ga0318545_1030713713300032042SoilLSRPPLVVAFELSEKRKAIVADALAGASDVVYLTDL
Ga0318533_1124756923300032059SoilMELSRPPLVIAFELSETRKAIVADTLAGASDVVYLTELD
Ga0318510_1037941723300032064SoilMEFSRPPLVIAFELSEPRKAIVADILAGVSDVVYLTE
Ga0318518_1045697313300032090SoilMDLSRPPLVVGFELSEKRKAIVADALAGASAVVYL
Ga0306920_10184965013300032261SoilMNLSRSPLVVTFKLSERRKAIVADVLAGASAVAYLTELDEAAEVLR
Ga0306920_10334762233300032261SoilLSRPPLVVAFELSEKRKAIVADALAGASDVVYLTELDE
Ga0306920_10384574223300032261SoilMEFSRPTLVIAFELSKKRKAIVADALVGASDVVYLTELD
Ga0310914_1129157913300033289SoilVVILGCMELSRPPLVVAFELSEKRKAIVADALAGA
Ga0334790_145143_592_7173300033887SoilMELSRPPLVVAFELSEKRKAIVADALAGASAVVYLTELDEAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.