NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090518

Metagenome / Metatranscriptome Family F090518

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090518
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 46 residues
Representative Sequence MTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Number of Associated Samples 93
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.22 %
% of genes near scaffold ends (potentially truncated) 45.37 %
% of genes from short scaffolds (< 2000 bps) 84.26 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.185 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil
(15.741 % of family members)
Environment Ontology (ENVO) Unclassified
(30.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.519 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02518HATPase_c 35.19
PF03401TctC 13.89
PF13185GAF_2 5.56
PF04392ABC_sub_bind 2.78
PF00881Nitroreductase 0.93
PF05532CsbD 0.93
PF07991IlvN 0.93
PF02653BPD_transp_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 13.89
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.78
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 1.85
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.93
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.19 %
UnclassifiedrootN/A39.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001227122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1078Open in IMG/M
2162886013|SwBSRL2_contig_5918534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1049Open in IMG/M
3300000890|JGI11643J12802_11935546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300000953|JGI11615J12901_10217948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum704Open in IMG/M
3300001904|JGI24736J21556_1072475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300003324|soilH2_10223773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3858Open in IMG/M
3300004009|Ga0055437_10072065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii971Open in IMG/M
3300004019|Ga0055439_10027137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii1427Open in IMG/M
3300004020|Ga0055440_10024452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter1206Open in IMG/M
3300004058|Ga0055498_10004350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1574Open in IMG/M
3300004114|Ga0062593_101887340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium660Open in IMG/M
3300004156|Ga0062589_100211298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1413Open in IMG/M
3300004156|Ga0062589_100406885Not Available1108Open in IMG/M
3300004156|Ga0062589_102108565Not Available575Open in IMG/M
3300004156|Ga0062589_102550706Not Available530Open in IMG/M
3300004281|Ga0066397_10098893Not Available609Open in IMG/M
3300004463|Ga0063356_103854393Not Available646Open in IMG/M
3300004479|Ga0062595_100560817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium878Open in IMG/M
3300004480|Ga0062592_100228511All Organisms → cellular organisms → Bacteria → Proteobacteria1342Open in IMG/M
3300004480|Ga0062592_102484776Not Available521Open in IMG/M
3300004643|Ga0062591_101550391Not Available665Open in IMG/M
3300004643|Ga0062591_102871451Not Available511Open in IMG/M
3300005104|Ga0066818_1010860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300005162|Ga0066814_10000387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter2592Open in IMG/M
3300005164|Ga0066815_10059949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300005290|Ga0065712_10186599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1143Open in IMG/M
3300005293|Ga0065715_10514232Not Available769Open in IMG/M
3300005295|Ga0065707_10116869Not Available2226Open in IMG/M
3300005332|Ga0066388_101803621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1088Open in IMG/M
3300005332|Ga0066388_102251777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum985Open in IMG/M
3300005332|Ga0066388_108637951Not Available506Open in IMG/M
3300005333|Ga0070677_10911382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300005344|Ga0070661_100009925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6606Open in IMG/M
3300005406|Ga0070703_10198363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales786Open in IMG/M
3300005458|Ga0070681_10628898Not Available988Open in IMG/M
3300005529|Ga0070741_10014652All Organisms → cellular organisms → Bacteria13513Open in IMG/M
3300005564|Ga0070664_100502179Not Available1118Open in IMG/M
3300005937|Ga0081455_10000508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales50455Open in IMG/M
3300006237|Ga0097621_102398283Not Available505Open in IMG/M
3300006852|Ga0075433_10043685All Organisms → cellular organisms → Bacteria → Proteobacteria3891Open in IMG/M
3300006852|Ga0075433_10800033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum824Open in IMG/M
3300006954|Ga0079219_10076082Not Available1557Open in IMG/M
3300009036|Ga0105244_10106000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1371Open in IMG/M
3300009100|Ga0075418_11746917Not Available676Open in IMG/M
3300009101|Ga0105247_10050267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2565Open in IMG/M
3300009101|Ga0105247_10804322Not Available718Open in IMG/M
3300009148|Ga0105243_10070822All Organisms → cellular organisms → Bacteria2817Open in IMG/M
3300009174|Ga0105241_10916394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales815Open in IMG/M
3300009553|Ga0105249_11899297Not Available668Open in IMG/M
3300010047|Ga0126382_12288705Not Available522Open in IMG/M
3300010047|Ga0126382_12300718Not Available521Open in IMG/M
3300010110|Ga0126316_1150381Not Available511Open in IMG/M
3300010359|Ga0126376_11490657Not Available705Open in IMG/M
3300010362|Ga0126377_10051243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3600Open in IMG/M
3300010362|Ga0126377_10149048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2196Open in IMG/M
3300010373|Ga0134128_11274439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp.810Open in IMG/M
3300010375|Ga0105239_10563452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1298Open in IMG/M
3300010375|Ga0105239_12143684Not Available650Open in IMG/M
3300010400|Ga0134122_10144804All Organisms → cellular organisms → Bacteria → Proteobacteria1926Open in IMG/M
3300011119|Ga0105246_10428960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1105Open in IMG/M
3300012477|Ga0157336_1013011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales667Open in IMG/M
3300012484|Ga0157333_1013645Not Available641Open in IMG/M
3300012507|Ga0157342_1007416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1063Open in IMG/M
3300012951|Ga0164300_10012928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2691Open in IMG/M
3300012960|Ga0164301_10145395Not Available1442Open in IMG/M
3300012986|Ga0164304_10217749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1258Open in IMG/M
3300013306|Ga0163162_13420280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300014262|Ga0075301_1140332Not Available555Open in IMG/M
3300014324|Ga0075352_1278972Not Available525Open in IMG/M
3300014497|Ga0182008_10180087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum1069Open in IMG/M
3300015371|Ga0132258_10123868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6148Open in IMG/M
3300015372|Ga0132256_100608329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1207Open in IMG/M
3300019356|Ga0173481_10000353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14629481Open in IMG/M
3300019361|Ga0173482_10158459Not Available889Open in IMG/M
3300022737|Ga0247747_1005473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1225Open in IMG/M
3300022898|Ga0247745_1000622Not Available4956Open in IMG/M
3300023168|Ga0247748_1011410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1176Open in IMG/M
3300025315|Ga0207697_10030694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602199Open in IMG/M
3300025551|Ga0210131_1093949Not Available520Open in IMG/M
3300025558|Ga0210139_1045132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii886Open in IMG/M
3300025900|Ga0207710_10578068Not Available586Open in IMG/M
3300025917|Ga0207660_11009274Not Available679Open in IMG/M
3300025920|Ga0207649_10985630Not Available663Open in IMG/M
3300025921|Ga0207652_11255934Not Available643Open in IMG/M
3300025942|Ga0207689_10393880Not Available1154Open in IMG/M
3300025957|Ga0210089_1005164All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300025986|Ga0207658_11637899Not Available588Open in IMG/M
3300026075|Ga0207708_10248941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1431Open in IMG/M
3300026142|Ga0207698_10236074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1663Open in IMG/M
3300026690|Ga0207494_102247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300026741|Ga0207510_100543Not Available1064Open in IMG/M
3300026773|Ga0207566_101260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria803Open in IMG/M
3300026806|Ga0207546_100418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1064Open in IMG/M
3300026861|Ga0207503_1000923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1308Open in IMG/M
3300026884|Ga0207455_1005700Not Available626Open in IMG/M
3300027775|Ga0209177_10062168Not Available1091Open in IMG/M
3300027775|Ga0209177_10089888Not Available954Open in IMG/M
3300027907|Ga0207428_10741058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum701Open in IMG/M
(restricted) 3300031150|Ga0255311_1029467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1143Open in IMG/M
(restricted) 3300031150|Ga0255311_1158434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales504Open in IMG/M
3300031716|Ga0310813_10000986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium17271Open in IMG/M
3300031820|Ga0307473_11557307Not Available503Open in IMG/M
3300031847|Ga0310907_10422081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium699Open in IMG/M
3300032000|Ga0310903_10553154Not Available607Open in IMG/M
3300032122|Ga0310895_10062693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1406Open in IMG/M
3300032174|Ga0307470_10065738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1933Open in IMG/M
3300033004|Ga0335084_10661920Not Available1066Open in IMG/M
3300033004|Ga0335084_11238682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales744Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil15.74%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.85%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.85%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005104Soil and rhizosphere microbial communities from Laval, Canada - mgHACEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010110Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026690Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026741Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes)EnvironmentalOpen in IMG/M
3300026773Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026806Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026861Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
20012509022001200001SoilMTKMSSKQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG
SwBSRL2_0795.000009902162886013Switchgrass RhizosphereMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
JGI11643J12802_1193554633300000890SoilMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLG
JGI11615J12901_1021794823300000953SoilMTKIELEQIDDSILHFEVSDEALESAGDNTVAANYTLGACTGLSVCPG*
JGI24736J21556_107247523300001904Corn RhizosphereMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCP
soilH2_1022377343300003324Sugarcane Root And Bulk SoilEDSILNYEISDEALESAGDNVASANYTLGACTGLSICPG*
Ga0055437_1007206523300004009Natural And Restored WetlandsMIKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG*
Ga0055439_1002713733300004019Natural And Restored WetlandsMTKIEPAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG*
Ga0055440_1002445213300004020Natural And Restored WetlandsMTKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG*
Ga0055498_1000435033300004058Natural And Restored WetlandsMTKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG*
Ga0062593_10188734013300004114SoilMTKIELAQTEDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG
Ga0062589_10021129833300004156SoilMTKIEFAQTEDSILNFEISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0062589_10040688523300004156SoilMTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG*
Ga0062589_10210856523300004156SoilMTKIEFAQTDDSILNFDVSDEAIESAGDNAIAANYTLGACTGLSVCPG*
Ga0062589_10255070623300004156SoilMTKIELEQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0066397_1009889323300004281Tropical Forest SoilMTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0063356_10385439313300004463Arabidopsis Thaliana RhizosphereMTKIELAQTEDSILNFEISDEALESAGDNVTAANYTLGACTGLSVCPG
Ga0062595_10056081723300004479SoilMTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVCPG*
Ga0062592_10022851133300004480SoilMTKIELAQTEDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG*
Ga0062592_10248477623300004480SoilMTKIELEQIDDSILNFNVSDEALESAGDNAAAANYTLGACTGLSVCPG*
Ga0062591_10155039113300004643SoilSQQKGIYAMTKIEFAQTEDSILNFEISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0062591_10287145113300004643SoilMTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVCPG
Ga0066818_101086013300005104SoilMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0066814_1000038743300005162SoilMTKIELEQIDEGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0066815_1005994913300005164SoilMTKIELEQIDEGILNFNVSDEALESAGDNAVAANYTLGACSGLSVCPG*
Ga0065712_1018659933300005290Miscanthus RhizosphereMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0065715_1051423223300005293Miscanthus RhizosphereMTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGLSVC
Ga0065707_1011686913300005295Switchgrass RhizosphereMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCP
Ga0066388_10180362133300005332Tropical Forest SoilMTKIELEQIDSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG*
Ga0066388_10225177733300005332Tropical Forest SoilMTKIELEQIDDSILNFNVSDEALESAGDNGVAANYTLGACTGLSVCPG*
Ga0066388_10863795113300005332Tropical Forest SoilAMTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0070677_1091138213300005333Miscanthus RhizosphereMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLS
Ga0070661_10000992513300005344Corn RhizosphereVRQLHRGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0070703_1019836313300005406Corn, Switchgrass And Miscanthus RhizosphereMTKIELEQIDDNILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0070681_1062889833300005458Corn RhizosphereMTKIELVQIDDSILNFDISDEALESAGDTTLAANYTLGACTGLSVCPG*
Ga0070741_1001465233300005529Surface SoilMTKFDLEMNEDSILNYEISDEALESAGDNVTAANYTLGACTGLSICPG*
Ga0070664_10050217913300005564Corn RhizosphereMTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG*
Ga0081455_10000508203300005937Tabebuia Heterophylla RhizosphereMTKIELEQIEILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0097621_10239828313300006237Miscanthus RhizosphereMTKIELAQTEDSILSFEISDEALESAGDNVTAANYTLGACTGL
Ga0075433_1004368513300006852Populus RhizosphereKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0075433_1080003313300006852Populus RhizosphereMTKIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0079219_1007608233300006954Agricultural SoilMTKIELEQIDILNFDISDEALESAGDNTVAANYTLGACTGLSVCPG*
Ga0105244_1010600013300009036Miscanthus RhizosphereMTKIELAQTEDSILSFEISDEALESAGDNVTAANYTL
Ga0075418_1174691733300009100Populus RhizosphereIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0105247_1005026733300009101Switchgrass RhizosphereMTKIELEQIDDNILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0105247_1080432223300009101Switchgrass RhizosphereHRGAVKKDLTMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0105243_1007082213300009148Miscanthus RhizosphereMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTSLSVCPG*
Ga0105241_1091639413300009174Corn RhizosphereAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0105249_1189929713300009553Switchgrass RhizosphereTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0126382_1228870523300010047Tropical Forest SoilDSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG*
Ga0126382_1230071813300010047Tropical Forest SoilMTTIELEQIDILNFDISDDALESAGDNAVAANYTLGACTGLSVCPG*
Ga0126316_115038113300010110SoilAMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0126376_1149065723300010359Tropical Forest SoilEKRKQAMTKIQLEQHEDSILNYEISDEALECAGDNVTAANYTLGACSGLSVCPG*
Ga0126377_1005124343300010362Tropical Forest SoilMTKIQLEQIDDSILSFEISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0126377_1014904823300010362Tropical Forest SoilMTKIELEQIDSILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0134128_1127443933300010373Terrestrial SoilIELVQIDDSILNFDIADEALESAGDTTLAANYTLGACTGLSVCPG*
Ga0105239_1056345223300010375Corn RhizosphereMTKIELAQTEDSILSFKISDEALESAGENVTAANYTLGACTGLSVCPG*
Ga0105239_1214368413300010375Corn RhizosphereMTKIELQQIDEGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0134122_1014480413300010400Terrestrial SoilMTKIDLDQHEDRILNYEISDEALESAGDNVTAANYTLGACSGLSVCPG*
Ga0105246_1042896013300011119Miscanthus RhizosphereAMTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG*
Ga0157336_101301113300012477Arabidopsis RhizosphereMTKIELEQIDDGILNFKVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0157333_101364513300012484SoilMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGL
Ga0157342_100741633300012507Arabidopsis RhizosphereMTKIELEQIDDSILNFDISDEALETAGDNAVAANYTLGACTGLSVCPG*
Ga0164300_1001292833300012951SoilMTKIELEQIDDSILNFNVSDEALESAGDNVVAANYTLGACTGLSVCPG*
Ga0164301_1014539523300012960SoilMTKLELEQIDDSIRNFNVSDEALASAGDNAVAANYTLGACTGLSVCPG*
Ga0164304_1021774913300012986SoilRGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0163162_1342028013300013306Switchgrass RhizosphereMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGL
Ga0075301_114033213300014262Natural And Restored WetlandsMTKIELEQIDDSILNFNVSDEALESSGDNVTAANYTLGACTGLSVCPG*
Ga0075352_127897213300014324Natural And Restored WetlandsTKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG*
Ga0182008_1018008723300014497RhizosphereMTKIELVQIDDSILNFDIADEALESAGDTTLAANYTLGACTGLSVCPG*
Ga0132258_1012386843300015371Arabidopsis RhizosphereMTKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG*
Ga0132256_10060832913300015372Arabidopsis RhizosphereDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG*
Ga0173481_1000035353300019356SoilMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0173482_1015845933300019361SoilMTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG
Ga0247747_100547323300022737SoilMTKIELEQIDDNILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0247745_100062213300022898SoilMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYT
Ga0247748_101141013300023168SoilQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0207697_1003069433300025315Corn, Switchgrass And Miscanthus RhizosphereMTKIELEQINDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0210131_109394923300025551Natural And Restored WetlandsTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG
Ga0210139_104513223300025558Natural And Restored WetlandsMTKIELAQTEDSILNFEISDEALESSGDNVTAANYTLGACTGLSVCPG
Ga0207710_1057806813300025900Switchgrass RhizosphereLEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0207660_1100927413300025917Corn RhizosphereMTKIELAQTDDSILNFDVSDEALESAGDNAIAANYTLG
Ga0207649_1098563023300025920Corn RhizosphereMTKIELAQTEDSILSFEISDEAIESAGDNVTAANYTLGACTGLSVCPG
Ga0207652_1125593413300025921Corn RhizosphereMTKIELAQTDDRILNFDVSDEALESAGDNAIAANYTLGACTGLSVCPG
Ga0207689_1039388013300025942Miscanthus RhizosphereMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTL
Ga0210089_100516423300025957Natural And Restored WetlandsMTKIEFAQTGDSILNFEISDEALESAGDNVNAANYTLGACTGLSVCPG
Ga0207658_1163789913300025986Switchgrass RhizosphereEDSILSFEISDEALESAGENVTAANYTLGACTGLSVCPG
Ga0207708_1024894113300026075Corn, Switchgrass And Miscanthus RhizosphereLEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0207698_1023607413300026142Corn RhizosphereMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLS
Ga0207494_10224723300026690SoilMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACT
Ga0207510_10054323300026741SoilMTKIELEQIDDGILNFNVSDEALESAGDNAVAANYTLG
Ga0207566_10126013300026773SoilMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYT
Ga0207546_10041823300026806SoilELEQIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0207503_100092313300026861SoilIDDGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0207455_100570023300026884SoilLHRGAVKKDLAMTKIELEQIDDSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0209177_1006216823300027775Agricultural SoilMTKIELEQIDILNFDISDEALESAGDNTVAANYTLGACTGLSVCPG
Ga0209177_1008988833300027775Agricultural SoilKIELVQIDDSILNFDISDEALESAGDTTLAANYTLGACTGLSVCPG
Ga0207428_1074105813300027907Populus RhizosphereMTKIELEQIDDSILHFEVSDEALESAGDNTVAANYTLGACTGLSVCPG
(restricted) Ga0255311_102946723300031150Sandy SoilMTKIELEQIDDSILNFDISDDALESAGDNAVAANYTLGACTGLSVCPG
(restricted) Ga0255311_115843413300031150Sandy SoilMTKIELEQIDDSILNFNVSDEALESAGDNAIAANYTLGACTGLSVCPG
Ga0310813_1000098673300031716SoilMTKIELEQIDVLNFDISDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0307473_1155730713300031820Hardwood Forest SoilMTTIELEQIDILNFDISDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0310907_1042208123300031847SoilMTKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG
Ga0310903_1055315413300032000SoilMHKIELEQIDDSILNFNVSDEALESAGDNTVAANYTLGACTGLSVCPG
Ga0310895_1006269313300032122SoilMTKIELEQIDDNILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG
Ga0307470_1006573833300032174Hardwood Forest SoilMTKIEFEQIDSILNFDISDEALESAGDNVVAANYTLGACTGLSVCPG
Ga0335084_1066192033300033004SoilMTKIELAQTEDSILSFEISDEALESAGENVTAAHYTLGACTGLSVCPG
Ga0335084_1123868213300033004SoilMTKIELEQIDVLNFDISDEALESASDNAVAANYTLGACTGLSVCPG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.