NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090644

Metagenome / Metatranscriptome Family F090644

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090644
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 40 residues
Representative Sequence SQASERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP
Number of Associated Samples 99
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 87.96 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.704 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(9.259 % of family members)
Environment Ontology (ENVO) Unclassified
(21.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.704 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF12840HTH_20 36.11
PF02310B12-binding 15.74
PF05036SPOR 7.41
PF04055Radical_SAM 4.63
PF01022HTH_5 2.78
PF01145Band_7 1.85
PF14534DUF4440 1.85
PF03544TonB_C 0.93
PF00165HTH_AraC 0.93
PF13432TPR_16 0.93
PF13249SQHop_cyclase_N 0.93
PF01569PAP2 0.93
PF07676PD40 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.70 %
UnclassifiedrootN/A21.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12644722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter870Open in IMG/M
3300001356|JGI12269J14319_10032469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3434Open in IMG/M
3300001356|JGI12269J14319_10118579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1229Open in IMG/M
3300001471|JGI12712J15308_10117185All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300001593|JGI12635J15846_10751725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae560Open in IMG/M
3300004152|Ga0062386_100354221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1176Open in IMG/M
3300005329|Ga0070683_102302428All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005526|Ga0073909_10015797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2378Open in IMG/M
3300005552|Ga0066701_10014236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3757Open in IMG/M
3300005563|Ga0068855_100678821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1104Open in IMG/M
3300005602|Ga0070762_10160320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1352Open in IMG/M
3300005602|Ga0070762_10445753All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300005712|Ga0070764_10393858All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300006052|Ga0075029_101058374Not Available562Open in IMG/M
3300006052|Ga0075029_101352282Not Available501Open in IMG/M
3300006059|Ga0075017_100541559All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300006059|Ga0075017_100845403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300006102|Ga0075015_100007808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4424Open in IMG/M
3300006162|Ga0075030_101026502All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006176|Ga0070765_101173058All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300006804|Ga0079221_11116222All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300007258|Ga0099793_10692251All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300009522|Ga0116218_1336857All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300009524|Ga0116225_1132286All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300009551|Ga0105238_11148737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300009638|Ga0116113_1210040Not Available506Open in IMG/M
3300009672|Ga0116215_1159535All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300009683|Ga0116224_10352855All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300009824|Ga0116219_10244199All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300009839|Ga0116223_10172482All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300010048|Ga0126373_10056669All Organisms → cellular organisms → Bacteria3500Open in IMG/M
3300010048|Ga0126373_10694840All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300010048|Ga0126373_11918576All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300010359|Ga0126376_12548689All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010361|Ga0126378_10804715All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300012201|Ga0137365_10571295All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300012683|Ga0137398_10368891All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300012923|Ga0137359_10317898Not Available1385Open in IMG/M
3300012988|Ga0164306_11017017All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300014166|Ga0134079_10393927All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300014489|Ga0182018_10002865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis16454Open in IMG/M
3300014658|Ga0181519_10170843Not Available1379Open in IMG/M
3300015089|Ga0167643_1069903All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300015195|Ga0167658_1051311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1011Open in IMG/M
3300017927|Ga0187824_10220794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300017930|Ga0187825_10440014Not Available504Open in IMG/M
3300017936|Ga0187821_10371014All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300017943|Ga0187819_10650865All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300017955|Ga0187817_10500334Not Available775Open in IMG/M
3300017955|Ga0187817_10560769All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300017970|Ga0187783_11069717All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017975|Ga0187782_10887845All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300018008|Ga0187888_1367844Not Available545Open in IMG/M
3300018038|Ga0187855_10332161All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300018057|Ga0187858_10637397Not Available640Open in IMG/M
3300018085|Ga0187772_10068833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2219Open in IMG/M
3300018088|Ga0187771_10061490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2949Open in IMG/M
3300018090|Ga0187770_10351374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → unclassified Ignavibacteriales → Ignavibacteriales bacterium1153Open in IMG/M
3300018431|Ga0066655_11423545Not Available504Open in IMG/M
3300018433|Ga0066667_10889100Not Available765Open in IMG/M
3300018468|Ga0066662_11838312All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300021046|Ga0215015_10059933All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021088|Ga0210404_10874021Not Available514Open in IMG/M
3300021180|Ga0210396_11505805Not Available553Open in IMG/M
3300021406|Ga0210386_10489556All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300021407|Ga0210383_10782704All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300021478|Ga0210402_10028681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4803Open in IMG/M
3300021860|Ga0213851_1075817Not Available519Open in IMG/M
3300022507|Ga0222729_1052033All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300022557|Ga0212123_10951127Not Available501Open in IMG/M
3300025414|Ga0208935_1037740Not Available642Open in IMG/M
3300025482|Ga0208715_1083090All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300025898|Ga0207692_10420783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300025944|Ga0207661_11111284All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026308|Ga0209265_1071733All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300026331|Ga0209267_1282255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300027370|Ga0209010_1025704All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300027603|Ga0209331_1012287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2234Open in IMG/M
3300027698|Ga0209446_1112766All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300027738|Ga0208989_10128391All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300027768|Ga0209772_10106562All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300027867|Ga0209167_10360559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis791Open in IMG/M
3300027882|Ga0209590_10656692All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300027905|Ga0209415_10537608All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300027911|Ga0209698_10517212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300027911|Ga0209698_10915148All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300028017|Ga0265356_1021231All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300028795|Ga0302227_10288273Not Available625Open in IMG/M
3300029908|Ga0311341_10675815All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300029914|Ga0311359_10504158Not Available920Open in IMG/M
3300030007|Ga0311338_11045729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae788Open in IMG/M
3300030056|Ga0302181_10410366Not Available583Open in IMG/M
3300030503|Ga0311370_10308082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2044Open in IMG/M
3300030503|Ga0311370_12433235Not Available506Open in IMG/M
3300030524|Ga0311357_10134452All Organisms → cellular organisms → Bacteria → Acidobacteria2454Open in IMG/M
3300031232|Ga0302323_103312628All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031236|Ga0302324_100874390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans1240Open in IMG/M
3300031708|Ga0310686_104213620Not Available569Open in IMG/M
3300031716|Ga0310813_11669089All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031753|Ga0307477_10903288All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031823|Ga0307478_11320412Not Available599Open in IMG/M
3300031938|Ga0308175_101568168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis736Open in IMG/M
3300031942|Ga0310916_10826907All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300032160|Ga0311301_11807936All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300032770|Ga0335085_10339811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1764Open in IMG/M
3300032805|Ga0335078_10125590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3666Open in IMG/M
3300033807|Ga0314866_081991All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300034163|Ga0370515_0504031Not Available511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.26%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.85%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.85%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1264472233300000789SoilQVSERFITLQDVTFELQRAQLGLLRSTGDLEKWALGK*
JGI12269J14319_1003246913300001356Peatlands SoilSQASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ*
JGI12269J14319_1011857933300001356Peatlands SoilSQASERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP*
JGI12712J15308_1011718523300001471Forest SoilSEKFISLQDITLELERSQLGLLRVAGDLEKWALAGN*
JGI12635J15846_1075172513300001593Forest SoilDARSQASERFITLQDVIFELERSQLGVLRSTGELEKWALGTP*
Ga0062386_10035422113300004152Bog Forest SoilRSQTSERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP*
Ga0070683_10230242823300005329Corn RhizosphereLDDARTQLSERFISLQDVNFELQRAQFGLMRSTGELEKWALGTQ*
Ga0073909_1001579743300005526Surface SoilSQVSERFITLQDVTFELQRAQLGLLHSTGDLEKWALGK*
Ga0066701_1001423653300005552SoilADERFLALQDATFELERARINLLRSTGDLEKWALGGQ*
Ga0068855_10067882113300005563Corn RhizosphereLSERFISLQDVNFELQRAQISLLRSTGDLEKWVLGTP*
Ga0070762_1016032033300005602SoilARSQVSERYIVLQDVTFELQRAQLGLLRSTGDLEKWALGK*
Ga0070762_1044575323300005602SoilLARTQANEKLIALQDVTFDLERTQVEYLRATGKLESWALGSN*
Ga0070764_1039385813300005712SoilASERLITLQDVTFELERSQVALMRATGDLESWALGAK*
Ga0075029_10105837423300006052WatershedsQLSERFIALQDVTLELQRSQLGLLRSTGDLEKWALGPK*
Ga0075029_10135228213300006052WatershedsTQASERLIRLQDVTFELERSQVALLRATGNLESWALGSK*
Ga0075017_10054155933300006059WatershedsARSQVSERFITLQNVTFELQRAQLGLLRSTGDLEKWALGK*
Ga0075017_10084540323300006059WatershedsDDARSQASERFIALQDVTFELGRAQLGLLRSTGDLEKWALGTP*
Ga0075015_10000780863300006102WatershedsQASERFMALQDVTFELERAQLGLLRSTGDLEKWALGTP*
Ga0075030_10102650223300006162WatershedsDLDDARTQASERFIALQDVTFELERSQVGVLRSTGDLEKWALGTP*
Ga0070765_10117305833300006176SoilDARTQASERLITLQDVTFELQRAQLGLLRSTGDLEKWALGK*
Ga0079221_1111622223300006804Agricultural SoilRFIALQDVNFNLECSQLGLLRSTGDLEKWALGTK*
Ga0099793_1069225123300007258Vadose Zone SoilSQASEHFIILQDVTFELQRSQITLLRSTGDLEKWALGSNN*
Ga0116218_133685723300009522Peatlands SoilASERFIALQDVTFELERAQLGLLRFTGDLEKWALGTP*
Ga0116225_113228633300009524Peatlands SoilDDARSQASERFITLQDVIFELERSQVGILRSTGDLEKWALGTP*
Ga0105238_1114873733300009551Corn RhizosphereQLSERFISLQDVTFELQRAELGLMRSTGELEKWALGSQ*
Ga0116113_121004023300009638PeatlandHDLDNAQTQASEKLIALQDVTFEVERNQVALLRANGNLESWALGTK*
Ga0116215_115953533300009672Peatlands SoilERFIALQDVTFELERSQLGLLRSTGDLEKWALGTP*
Ga0116224_1035285523300009683Peatlands SoilARSQASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ*
Ga0116219_1024419913300009824Peatlands SoilQASERSIALQDVNFELERSQVGVLRSTGDLEKWALGTP*
Ga0116223_1017248213300009839Peatlands SoilASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ*
Ga0126373_1005666953300010048Tropical Forest SoilRFITLQDVTFELQRAQLGLLRSTGDLEKWALGTH*
Ga0126373_1069484033300010048Tropical Forest SoilHDLDDARAQLSERFMTLQDVSFDLQRTQLGLLRSTGDLEKWALGTH*
Ga0126373_1191857613300010048Tropical Forest SoilLDDARAQLSERFMTLQDVTFDLQRTQLGLLRSTGDLEKWALGTH*
Ga0126376_1254868923300010359Tropical Forest SoilDLDDARSQMSERSITLQDVTFELQRAQLGLLRSTGDLEKWALGK*
Ga0126378_1080471513300010361Tropical Forest SoilQLSERFMTLQDVSFDLQRTQLGLLRSTGDLEKWALGTH*
Ga0137365_1057129523300012201Vadose Zone SoilDARSQASEHFITLQDVTFELQRSQVTLLRSTGDLEKWALGSNH*
Ga0137398_1036889123300012683Vadose Zone SoilRAQASERFIALQDVLFELERTQVGLMRATGDLERWALGTP*
Ga0137359_1031789813300012923Vadose Zone SoilRTQSSERFIALQDVTFELERTQVALMRATGDLEIWALK*
Ga0164306_1101701723300012988SoilLDDARSQASERFITLQDVTFELERSQLGLLRSTGDLEKWALGK*
Ga0134079_1039392713300014166Grasslands SoilRSQVSERYIVLQDVTFELQRAELGLLRSTGDLEKWALGK*
Ga0182018_10002865173300014489PalsaRFITFQDVTFELERSQVSLLRATGDLESWALGSK*
Ga0181519_1017084313300014658BogASERLIALQDVAFELERSQIALLRATGGLENWATGAP*
Ga0167643_106990313300015089Glacier Forefield SoilLDDARSQSSERFITLQDVTFELERSQLGMLRSTGDLERWALGTP*
Ga0167658_105131133300015195Glacier Forefield SoilRSQASERFIALQDVTFELERSQLGVLRSTGDLEKWALGTR*
Ga0187824_1022079413300017927Freshwater SedimentSERFIALQDVTFELQRAQLGLLRTTGDLEKWALGTP
Ga0187825_1044001413300017930Freshwater SedimentASERFISLQDVAFELERTQVSLLRSTGDLEKWALGTN
Ga0187821_1037101413300017936Freshwater SedimentASERFIALQDVTFELQRAQLGLLRTTGDLEKWALGTP
Ga0187819_1065086513300017943Freshwater SedimentQASERFIALQDVTFDLERAQLGLLRSTGDLEKWAMGTP
Ga0187817_1050033413300017955Freshwater SedimentAMTQASERFIALQDISFGLQRSQVGLLRSMGDLEKWATGAN
Ga0187817_1056076923300017955Freshwater SedimentIHDLADARSQVSERFIAMQDVTFELERAQLGLLRSTGDLEKWALGAH
Ga0187783_1106971723300017970Tropical PeatlandSQASERFITLQDVTFELEKGQVELMRATGALESWALGH
Ga0187782_1088784523300017975Tropical PeatlandQASERLIALQDTTFELERSQVALMHATGNLETWASGAK
Ga0187888_136784413300018008PeatlandARSQASERFITLQDVTFDLERSQVALLRAKGQLQAWAEGMK
Ga0187855_1033216123300018038PeatlandERFITLQDVTFELERSQLGLLRSTGDLEHWALGPH
Ga0187858_1063739713300018057PeatlandARTQSSEKLISLQDVTFELERTQVALLRATGSLETWALGTK
Ga0187772_1006883343300018085Tropical PeatlandSERFIALQDVTFELQRAQLGLLRSTGDLEKWALRAP
Ga0187771_1006149053300018088Tropical PeatlandASERFIALQDVSFELERAQLGLLRSTGDLEKWALGSR
Ga0187770_1035137423300018090Tropical PeatlandLDDARSQLSERFITLQDVSFELQRAQLGLLRSTGDLETWALGGR
Ga0066655_1142354513300018431Grasslands SoilERFIALQDVSFELERSQVGLMRATGELERWAIGGR
Ga0066667_1088910013300018433Grasslands SoilASERFIALQDVSFELERSQVGLMRATGELERWAIGGR
Ga0066662_1183831223300018468Grasslands SoilERFISLQDVNFELQRAQLGLMRSTGELEKWALGTQ
Ga0215015_1005993323300021046SoilDDARSQASEHFITLQDVTFELQRSQITLLRSTGDLEKWALGSSN
Ga0210404_1087402113300021088SoilERFIALQDVTFELERSQVTLLRSTGDLETWALGTK
Ga0210396_1150580523300021180SoilECLITLQDVTFQLERSQVALMRATGDLEAWALSTK
Ga0210386_1048955633300021406SoilSERFITLQDVTFELERSQLGVLRSTGELEKWALGTP
Ga0210383_1078270413300021407SoilSERLITLQDVTFELERSQVALLRATGDLEKWAMGIK
Ga0210402_1002868173300021478SoilDLDDARSQVSERFIALQDVTFELERSQLGVLRSTGDLEKWALGMQ
Ga0213851_107581713300021860WatershedsLHDLDDARSQASERFITFQDVTFELERSQLGVMRSTGDLEKWALGTP
Ga0222729_105203313300022507SoilRSQASERFIALQDVTFELERSQLGLLRSTGDLEKWALGAP
Ga0212123_1095112713300022557Iron-Sulfur Acid SpringDEADARNQVNERYNALQDSNFELERARITLLRSTGDLEKWAMGEN
Ga0208935_103774023300025414PeatlandASERLISLQDVSFELERSQVALLRATGDLEAWALGTK
Ga0208715_108309023300025482Arctic Peat SoilQASERFITLQDVTFELERSELGVLRSTGDLEKWALGTH
Ga0207692_1042078313300025898Corn, Switchgrass And Miscanthus RhizosphereLDDARTQLSERFISLQDVNFELQRAQLGLMRSTGELEKWALGTQ
Ga0207661_1111128413300025944Corn RhizosphereQLSERFISLQDVNFELQRAQFGLMRSTGELEKWALGTQ
Ga0209265_107173333300026308SoilTQLSERFIALQDVTFELQRAQLALMRSTGDLEKWALGQ
Ga0209267_128225513300026331SoilDLADARTQADERFLALQDATFELERARINLLRSTGDLEKWALGGQ
Ga0209010_102570423300027370Forest SoilASERFIILQDVSFELERNELGVLRSTGDLEKWALETP
Ga0209331_101228733300027603Forest SoilQASEHFITLQDVAFELQRSQITLLRSTGDLEKWALGSNN
Ga0209446_111276613300027698Bog Forest SoilAQASERLITLQDVTFELERSQVALLRATGDLESWALGTR
Ga0208989_1012839123300027738Forest SoilDARSQASEHFITLQDVTFELERSQITLLRSTGDLEKWALGGNN
Ga0209772_1010656223300027768Bog Forest SoilAQAQASERLITLQDVGFELERSQVALMRATGDLETWALGTK
Ga0209167_1036055933300027867Surface SoilHELDDAHSQVGERFIALQDVTFELQRAQLGLLRATGELEKWVLGPR
Ga0209590_1065669223300027882Vadose Zone SoilQASEHFIAFQDVTFELERSQVSLLRATGNLESWALGTK
Ga0209415_1053760813300027905Peatlands SoilRDLDDARTQASERFIALQDVTFELERSQLGVLRSTGDLEKWALGTP
Ga0209698_1051721213300027911WatershedsIHDLDDARSQASERYIALQDVTFELERAQLGLLRSTGELEKWALGTP
Ga0209698_1091514823300027911WatershedsLHDLDDARTQASERFIALQDVTFELERSQVGVLRSTGDLEKWALGTP
Ga0265356_102123123300028017RhizosphereASERFITLQDVTFELERSQVALLRATGDLEHWVLGGK
Ga0302227_1028827313300028795PalsaERFIALQDVTFELERSQVEVLRSTGDLESWALGAK
Ga0311341_1067581523300029908BogLDSAQIQASERLITLQDVTFELERSQVALMRATGELETWALGPK
Ga0311359_1050415823300029914BogERFISLQDVTFELERSQVELMRATGDLETWALGAK
Ga0311338_1104572913300030007PalsaQASEHFIALQDVTLELQRSQLGVLRSTGELEKWALGTP
Ga0302181_1041036623300030056PalsaSERLITLQDVTFELERSQVTLLRATGNLESWALGTK
Ga0311370_1030808213300030503PalsaRFIALQDVTFNLQRTQLGLLRSTGDLEQWALGTSK
Ga0311370_1243323513300030503PalsaQSSEKLIALQDVTFELERNQIALLRATGNLETWALGK
Ga0311357_1013445243300030524PalsaARSQASERFIALQDVTFELERSQVEVLRSTGDLESWALGAK
Ga0302323_10331262823300031232FenERFIALQDVSFELERANLGLMRATGDLEKWALGGR
Ga0302324_10087439013300031236PalsaAQTQASERLITLQDVTFELERSQIALLRATGNLESWALGSK
Ga0310686_10421362023300031708SoilSIASERLITLQDVTFELERSQVALLRATGDLEKWAMGSK
Ga0310813_1166908913300031716SoilDARTQVSERFIALQDVNFNLECSQLGLLRSTGDLEKWALGTK
Ga0307477_1090328823300031753Hardwood Forest SoilDARSQASERFITLQDVTFELERSQLGVLRSTGDLEKWALGTP
Ga0307478_1132041223300031823Hardwood Forest SoilQANEKLIVLQDVTFELERSQVALLRATGGLEGWALGSK
Ga0308175_10156816833300031938SoilTQFSERFIALQDVTFELQRAQLGLLRSTGELEKWALGTH
Ga0310916_1082690713300031942SoilLHDLDDARAQVSERFITLQDVTFELQRAQLGLLRSTGDLEKWALGK
Ga0311301_1180793633300032160Peatlands SoilSEASERFIALQDVIFELERAQLGLLRSTGDLEKWALGNP
Ga0335085_1033981113300032770SoilDNARALVRERFITLQDVTFELQRAQLGLIRSTGDLEKWALGK
Ga0335078_1012559063300032805SoilRTQASERFIALQDITFELERSEVGLMRSTGELEKWAMGR
Ga0314866_081991_2_1183300033807PeatlandRSQASEKFIALQDVTFELERAQLGLLRSTGELEKWVMR
Ga0370515_0504031_3_1313300034163Untreated Peat SoilDDARSKASEHSITLEDIIFELERSQVALLRATGDLEKWAMGQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.