Basic Information | |
---|---|
Family ID | F090644 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 40 residues |
Representative Sequence | SQASERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 87.96 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.704 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (9.259 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.296 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.704 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF12840 | HTH_20 | 36.11 |
PF02310 | B12-binding | 15.74 |
PF05036 | SPOR | 7.41 |
PF04055 | Radical_SAM | 4.63 |
PF01022 | HTH_5 | 2.78 |
PF01145 | Band_7 | 1.85 |
PF14534 | DUF4440 | 1.85 |
PF03544 | TonB_C | 0.93 |
PF00165 | HTH_AraC | 0.93 |
PF13432 | TPR_16 | 0.93 |
PF13249 | SQHop_cyclase_N | 0.93 |
PF01569 | PAP2 | 0.93 |
PF07676 | PD40 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.70 % |
Unclassified | root | N/A | 21.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12644722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 870 | Open in IMG/M |
3300001356|JGI12269J14319_10032469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3434 | Open in IMG/M |
3300001356|JGI12269J14319_10118579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1229 | Open in IMG/M |
3300001471|JGI12712J15308_10117185 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300001593|JGI12635J15846_10751725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
3300004152|Ga0062386_100354221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1176 | Open in IMG/M |
3300005329|Ga0070683_102302428 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005526|Ga0073909_10015797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2378 | Open in IMG/M |
3300005552|Ga0066701_10014236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3757 | Open in IMG/M |
3300005563|Ga0068855_100678821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1104 | Open in IMG/M |
3300005602|Ga0070762_10160320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1352 | Open in IMG/M |
3300005602|Ga0070762_10445753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300005712|Ga0070764_10393858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300006052|Ga0075029_101058374 | Not Available | 562 | Open in IMG/M |
3300006052|Ga0075029_101352282 | Not Available | 501 | Open in IMG/M |
3300006059|Ga0075017_100541559 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300006059|Ga0075017_100845403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300006102|Ga0075015_100007808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4424 | Open in IMG/M |
3300006162|Ga0075030_101026502 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300006176|Ga0070765_101173058 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300006804|Ga0079221_11116222 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300007258|Ga0099793_10692251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300009522|Ga0116218_1336857 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300009524|Ga0116225_1132286 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300009551|Ga0105238_11148737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300009638|Ga0116113_1210040 | Not Available | 506 | Open in IMG/M |
3300009672|Ga0116215_1159535 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300009683|Ga0116224_10352855 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009824|Ga0116219_10244199 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300009839|Ga0116223_10172482 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300010048|Ga0126373_10056669 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
3300010048|Ga0126373_10694840 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300010048|Ga0126373_11918576 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300010359|Ga0126376_12548689 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010361|Ga0126378_10804715 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300012201|Ga0137365_10571295 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300012683|Ga0137398_10368891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300012923|Ga0137359_10317898 | Not Available | 1385 | Open in IMG/M |
3300012988|Ga0164306_11017017 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300014166|Ga0134079_10393927 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300014489|Ga0182018_10002865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 16454 | Open in IMG/M |
3300014658|Ga0181519_10170843 | Not Available | 1379 | Open in IMG/M |
3300015089|Ga0167643_1069903 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300015195|Ga0167658_1051311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1011 | Open in IMG/M |
3300017927|Ga0187824_10220794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300017930|Ga0187825_10440014 | Not Available | 504 | Open in IMG/M |
3300017936|Ga0187821_10371014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300017943|Ga0187819_10650865 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300017955|Ga0187817_10500334 | Not Available | 775 | Open in IMG/M |
3300017955|Ga0187817_10560769 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300017970|Ga0187783_11069717 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300017975|Ga0187782_10887845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300018008|Ga0187888_1367844 | Not Available | 545 | Open in IMG/M |
3300018038|Ga0187855_10332161 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300018057|Ga0187858_10637397 | Not Available | 640 | Open in IMG/M |
3300018085|Ga0187772_10068833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2219 | Open in IMG/M |
3300018088|Ga0187771_10061490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2949 | Open in IMG/M |
3300018090|Ga0187770_10351374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → unclassified Ignavibacteriales → Ignavibacteriales bacterium | 1153 | Open in IMG/M |
3300018431|Ga0066655_11423545 | Not Available | 504 | Open in IMG/M |
3300018433|Ga0066667_10889100 | Not Available | 765 | Open in IMG/M |
3300018468|Ga0066662_11838312 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300021046|Ga0215015_10059933 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300021088|Ga0210404_10874021 | Not Available | 514 | Open in IMG/M |
3300021180|Ga0210396_11505805 | Not Available | 553 | Open in IMG/M |
3300021406|Ga0210386_10489556 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300021407|Ga0210383_10782704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300021478|Ga0210402_10028681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4803 | Open in IMG/M |
3300021860|Ga0213851_1075817 | Not Available | 519 | Open in IMG/M |
3300022507|Ga0222729_1052033 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300022557|Ga0212123_10951127 | Not Available | 501 | Open in IMG/M |
3300025414|Ga0208935_1037740 | Not Available | 642 | Open in IMG/M |
3300025482|Ga0208715_1083090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300025898|Ga0207692_10420783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
3300025944|Ga0207661_11111284 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300026308|Ga0209265_1071733 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300026331|Ga0209267_1282255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300027370|Ga0209010_1025704 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300027603|Ga0209331_1012287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2234 | Open in IMG/M |
3300027698|Ga0209446_1112766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300027738|Ga0208989_10128391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300027768|Ga0209772_10106562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300027867|Ga0209167_10360559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 791 | Open in IMG/M |
3300027882|Ga0209590_10656692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300027905|Ga0209415_10537608 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300027911|Ga0209698_10517212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300027911|Ga0209698_10915148 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300028017|Ga0265356_1021231 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300028795|Ga0302227_10288273 | Not Available | 625 | Open in IMG/M |
3300029908|Ga0311341_10675815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300029914|Ga0311359_10504158 | Not Available | 920 | Open in IMG/M |
3300030007|Ga0311338_11045729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 788 | Open in IMG/M |
3300030056|Ga0302181_10410366 | Not Available | 583 | Open in IMG/M |
3300030503|Ga0311370_10308082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2044 | Open in IMG/M |
3300030503|Ga0311370_12433235 | Not Available | 506 | Open in IMG/M |
3300030524|Ga0311357_10134452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2454 | Open in IMG/M |
3300031232|Ga0302323_103312628 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031236|Ga0302324_100874390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1240 | Open in IMG/M |
3300031708|Ga0310686_104213620 | Not Available | 569 | Open in IMG/M |
3300031716|Ga0310813_11669089 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031753|Ga0307477_10903288 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300031823|Ga0307478_11320412 | Not Available | 599 | Open in IMG/M |
3300031938|Ga0308175_101568168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 736 | Open in IMG/M |
3300031942|Ga0310916_10826907 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300032160|Ga0311301_11807936 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300032770|Ga0335085_10339811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1764 | Open in IMG/M |
3300032805|Ga0335078_10125590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3666 | Open in IMG/M |
3300033807|Ga0314866_081991 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300034163|Ga0370515_0504031 | Not Available | 511 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.26% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.63% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.78% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.85% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.85% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_126447223 | 3300000789 | Soil | QVSERFITLQDVTFELQRAQLGLLRSTGDLEKWALGK* |
JGI12269J14319_100324691 | 3300001356 | Peatlands Soil | SQASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ* |
JGI12269J14319_101185793 | 3300001356 | Peatlands Soil | SQASERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP* |
JGI12712J15308_101171852 | 3300001471 | Forest Soil | SEKFISLQDITLELERSQLGLLRVAGDLEKWALAGN* |
JGI12635J15846_107517251 | 3300001593 | Forest Soil | DARSQASERFITLQDVIFELERSQLGVLRSTGELEKWALGTP* |
Ga0062386_1003542211 | 3300004152 | Bog Forest Soil | RSQTSERFIALQDVTFELERAQLGLLRSTGDLEKWALGTP* |
Ga0070683_1023024282 | 3300005329 | Corn Rhizosphere | LDDARTQLSERFISLQDVNFELQRAQFGLMRSTGELEKWALGTQ* |
Ga0073909_100157974 | 3300005526 | Surface Soil | SQVSERFITLQDVTFELQRAQLGLLHSTGDLEKWALGK* |
Ga0066701_100142365 | 3300005552 | Soil | ADERFLALQDATFELERARINLLRSTGDLEKWALGGQ* |
Ga0068855_1006788211 | 3300005563 | Corn Rhizosphere | LSERFISLQDVNFELQRAQISLLRSTGDLEKWVLGTP* |
Ga0070762_101603203 | 3300005602 | Soil | ARSQVSERYIVLQDVTFELQRAQLGLLRSTGDLEKWALGK* |
Ga0070762_104457532 | 3300005602 | Soil | LARTQANEKLIALQDVTFDLERTQVEYLRATGKLESWALGSN* |
Ga0070764_103938581 | 3300005712 | Soil | ASERLITLQDVTFELERSQVALMRATGDLESWALGAK* |
Ga0075029_1010583742 | 3300006052 | Watersheds | QLSERFIALQDVTLELQRSQLGLLRSTGDLEKWALGPK* |
Ga0075029_1013522821 | 3300006052 | Watersheds | TQASERLIRLQDVTFELERSQVALLRATGNLESWALGSK* |
Ga0075017_1005415593 | 3300006059 | Watersheds | ARSQVSERFITLQNVTFELQRAQLGLLRSTGDLEKWALGK* |
Ga0075017_1008454032 | 3300006059 | Watersheds | DDARSQASERFIALQDVTFELGRAQLGLLRSTGDLEKWALGTP* |
Ga0075015_1000078086 | 3300006102 | Watersheds | QASERFMALQDVTFELERAQLGLLRSTGDLEKWALGTP* |
Ga0075030_1010265022 | 3300006162 | Watersheds | DLDDARTQASERFIALQDVTFELERSQVGVLRSTGDLEKWALGTP* |
Ga0070765_1011730583 | 3300006176 | Soil | DARTQASERLITLQDVTFELQRAQLGLLRSTGDLEKWALGK* |
Ga0079221_111162222 | 3300006804 | Agricultural Soil | RFIALQDVNFNLECSQLGLLRSTGDLEKWALGTK* |
Ga0099793_106922512 | 3300007258 | Vadose Zone Soil | SQASEHFIILQDVTFELQRSQITLLRSTGDLEKWALGSNN* |
Ga0116218_13368572 | 3300009522 | Peatlands Soil | ASERFIALQDVTFELERAQLGLLRFTGDLEKWALGTP* |
Ga0116225_11322863 | 3300009524 | Peatlands Soil | DDARSQASERFITLQDVIFELERSQVGILRSTGDLEKWALGTP* |
Ga0105238_111487373 | 3300009551 | Corn Rhizosphere | QLSERFISLQDVTFELQRAELGLMRSTGELEKWALGSQ* |
Ga0116113_12100402 | 3300009638 | Peatland | HDLDNAQTQASEKLIALQDVTFEVERNQVALLRANGNLESWALGTK* |
Ga0116215_11595353 | 3300009672 | Peatlands Soil | ERFIALQDVTFELERSQLGLLRSTGDLEKWALGTP* |
Ga0116224_103528552 | 3300009683 | Peatlands Soil | ARSQASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ* |
Ga0116219_102441991 | 3300009824 | Peatlands Soil | QASERSIALQDVNFELERSQVGVLRSTGDLEKWALGTP* |
Ga0116223_101724821 | 3300009839 | Peatlands Soil | ASERFIALQDVTFELERAQLGLLRSTGDLERWALGTPQ* |
Ga0126373_100566695 | 3300010048 | Tropical Forest Soil | RFITLQDVTFELQRAQLGLLRSTGDLEKWALGTH* |
Ga0126373_106948403 | 3300010048 | Tropical Forest Soil | HDLDDARAQLSERFMTLQDVSFDLQRTQLGLLRSTGDLEKWALGTH* |
Ga0126373_119185761 | 3300010048 | Tropical Forest Soil | LDDARAQLSERFMTLQDVTFDLQRTQLGLLRSTGDLEKWALGTH* |
Ga0126376_125486892 | 3300010359 | Tropical Forest Soil | DLDDARSQMSERSITLQDVTFELQRAQLGLLRSTGDLEKWALGK* |
Ga0126378_108047151 | 3300010361 | Tropical Forest Soil | QLSERFMTLQDVSFDLQRTQLGLLRSTGDLEKWALGTH* |
Ga0137365_105712952 | 3300012201 | Vadose Zone Soil | DARSQASEHFITLQDVTFELQRSQVTLLRSTGDLEKWALGSNH* |
Ga0137398_103688912 | 3300012683 | Vadose Zone Soil | RAQASERFIALQDVLFELERTQVGLMRATGDLERWALGTP* |
Ga0137359_103178981 | 3300012923 | Vadose Zone Soil | RTQSSERFIALQDVTFELERTQVALMRATGDLEIWALK* |
Ga0164306_110170172 | 3300012988 | Soil | LDDARSQASERFITLQDVTFELERSQLGLLRSTGDLEKWALGK* |
Ga0134079_103939271 | 3300014166 | Grasslands Soil | RSQVSERYIVLQDVTFELQRAELGLLRSTGDLEKWALGK* |
Ga0182018_1000286517 | 3300014489 | Palsa | RFITFQDVTFELERSQVSLLRATGDLESWALGSK* |
Ga0181519_101708431 | 3300014658 | Bog | ASERLIALQDVAFELERSQIALLRATGGLENWATGAP* |
Ga0167643_10699031 | 3300015089 | Glacier Forefield Soil | LDDARSQSSERFITLQDVTFELERSQLGMLRSTGDLERWALGTP* |
Ga0167658_10513113 | 3300015195 | Glacier Forefield Soil | RSQASERFIALQDVTFELERSQLGVLRSTGDLEKWALGTR* |
Ga0187824_102207941 | 3300017927 | Freshwater Sediment | SERFIALQDVTFELQRAQLGLLRTTGDLEKWALGTP |
Ga0187825_104400141 | 3300017930 | Freshwater Sediment | ASERFISLQDVAFELERTQVSLLRSTGDLEKWALGTN |
Ga0187821_103710141 | 3300017936 | Freshwater Sediment | ASERFIALQDVTFELQRAQLGLLRTTGDLEKWALGTP |
Ga0187819_106508651 | 3300017943 | Freshwater Sediment | QASERFIALQDVTFDLERAQLGLLRSTGDLEKWAMGTP |
Ga0187817_105003341 | 3300017955 | Freshwater Sediment | AMTQASERFIALQDISFGLQRSQVGLLRSMGDLEKWATGAN |
Ga0187817_105607692 | 3300017955 | Freshwater Sediment | IHDLADARSQVSERFIAMQDVTFELERAQLGLLRSTGDLEKWALGAH |
Ga0187783_110697172 | 3300017970 | Tropical Peatland | SQASERFITLQDVTFELEKGQVELMRATGALESWALGH |
Ga0187782_108878452 | 3300017975 | Tropical Peatland | QASERLIALQDTTFELERSQVALMHATGNLETWASGAK |
Ga0187888_13678441 | 3300018008 | Peatland | ARSQASERFITLQDVTFDLERSQVALLRAKGQLQAWAEGMK |
Ga0187855_103321612 | 3300018038 | Peatland | ERFITLQDVTFELERSQLGLLRSTGDLEHWALGPH |
Ga0187858_106373971 | 3300018057 | Peatland | ARTQSSEKLISLQDVTFELERTQVALLRATGSLETWALGTK |
Ga0187772_100688334 | 3300018085 | Tropical Peatland | SERFIALQDVTFELQRAQLGLLRSTGDLEKWALRAP |
Ga0187771_100614905 | 3300018088 | Tropical Peatland | ASERFIALQDVSFELERAQLGLLRSTGDLEKWALGSR |
Ga0187770_103513742 | 3300018090 | Tropical Peatland | LDDARSQLSERFITLQDVSFELQRAQLGLLRSTGDLETWALGGR |
Ga0066655_114235451 | 3300018431 | Grasslands Soil | ERFIALQDVSFELERSQVGLMRATGELERWAIGGR |
Ga0066667_108891001 | 3300018433 | Grasslands Soil | ASERFIALQDVSFELERSQVGLMRATGELERWAIGGR |
Ga0066662_118383122 | 3300018468 | Grasslands Soil | ERFISLQDVNFELQRAQLGLMRSTGELEKWALGTQ |
Ga0215015_100599332 | 3300021046 | Soil | DDARSQASEHFITLQDVTFELQRSQITLLRSTGDLEKWALGSSN |
Ga0210404_108740211 | 3300021088 | Soil | ERFIALQDVTFELERSQVTLLRSTGDLETWALGTK |
Ga0210396_115058052 | 3300021180 | Soil | ECLITLQDVTFQLERSQVALMRATGDLEAWALSTK |
Ga0210386_104895563 | 3300021406 | Soil | SERFITLQDVTFELERSQLGVLRSTGELEKWALGTP |
Ga0210383_107827041 | 3300021407 | Soil | SERLITLQDVTFELERSQVALLRATGDLEKWAMGIK |
Ga0210402_100286817 | 3300021478 | Soil | DLDDARSQVSERFIALQDVTFELERSQLGVLRSTGDLEKWALGMQ |
Ga0213851_10758171 | 3300021860 | Watersheds | LHDLDDARSQASERFITFQDVTFELERSQLGVMRSTGDLEKWALGTP |
Ga0222729_10520331 | 3300022507 | Soil | RSQASERFIALQDVTFELERSQLGLLRSTGDLEKWALGAP |
Ga0212123_109511271 | 3300022557 | Iron-Sulfur Acid Spring | DEADARNQVNERYNALQDSNFELERARITLLRSTGDLEKWAMGEN |
Ga0208935_10377402 | 3300025414 | Peatland | ASERLISLQDVSFELERSQVALLRATGDLEAWALGTK |
Ga0208715_10830902 | 3300025482 | Arctic Peat Soil | QASERFITLQDVTFELERSELGVLRSTGDLEKWALGTH |
Ga0207692_104207831 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LDDARTQLSERFISLQDVNFELQRAQLGLMRSTGELEKWALGTQ |
Ga0207661_111112841 | 3300025944 | Corn Rhizosphere | QLSERFISLQDVNFELQRAQFGLMRSTGELEKWALGTQ |
Ga0209265_10717333 | 3300026308 | Soil | TQLSERFIALQDVTFELQRAQLALMRSTGDLEKWALGQ |
Ga0209267_12822551 | 3300026331 | Soil | DLADARTQADERFLALQDATFELERARINLLRSTGDLEKWALGGQ |
Ga0209010_10257042 | 3300027370 | Forest Soil | ASERFIILQDVSFELERNELGVLRSTGDLEKWALETP |
Ga0209331_10122873 | 3300027603 | Forest Soil | QASEHFITLQDVAFELQRSQITLLRSTGDLEKWALGSNN |
Ga0209446_11127661 | 3300027698 | Bog Forest Soil | AQASERLITLQDVTFELERSQVALLRATGDLESWALGTR |
Ga0208989_101283912 | 3300027738 | Forest Soil | DARSQASEHFITLQDVTFELERSQITLLRSTGDLEKWALGGNN |
Ga0209772_101065622 | 3300027768 | Bog Forest Soil | AQAQASERLITLQDVGFELERSQVALMRATGDLETWALGTK |
Ga0209167_103605593 | 3300027867 | Surface Soil | HELDDAHSQVGERFIALQDVTFELQRAQLGLLRATGELEKWVLGPR |
Ga0209590_106566922 | 3300027882 | Vadose Zone Soil | QASEHFIAFQDVTFELERSQVSLLRATGNLESWALGTK |
Ga0209415_105376081 | 3300027905 | Peatlands Soil | RDLDDARTQASERFIALQDVTFELERSQLGVLRSTGDLEKWALGTP |
Ga0209698_105172121 | 3300027911 | Watersheds | IHDLDDARSQASERYIALQDVTFELERAQLGLLRSTGELEKWALGTP |
Ga0209698_109151482 | 3300027911 | Watersheds | LHDLDDARTQASERFIALQDVTFELERSQVGVLRSTGDLEKWALGTP |
Ga0265356_10212312 | 3300028017 | Rhizosphere | ASERFITLQDVTFELERSQVALLRATGDLEHWVLGGK |
Ga0302227_102882731 | 3300028795 | Palsa | ERFIALQDVTFELERSQVEVLRSTGDLESWALGAK |
Ga0311341_106758152 | 3300029908 | Bog | LDSAQIQASERLITLQDVTFELERSQVALMRATGELETWALGPK |
Ga0311359_105041582 | 3300029914 | Bog | ERFISLQDVTFELERSQVELMRATGDLETWALGAK |
Ga0311338_110457291 | 3300030007 | Palsa | QASEHFIALQDVTLELQRSQLGVLRSTGELEKWALGTP |
Ga0302181_104103662 | 3300030056 | Palsa | SERLITLQDVTFELERSQVTLLRATGNLESWALGTK |
Ga0311370_103080821 | 3300030503 | Palsa | RFIALQDVTFNLQRTQLGLLRSTGDLEQWALGTSK |
Ga0311370_124332351 | 3300030503 | Palsa | QSSEKLIALQDVTFELERNQIALLRATGNLETWALGK |
Ga0311357_101344524 | 3300030524 | Palsa | ARSQASERFIALQDVTFELERSQVEVLRSTGDLESWALGAK |
Ga0302323_1033126282 | 3300031232 | Fen | ERFIALQDVSFELERANLGLMRATGDLEKWALGGR |
Ga0302324_1008743901 | 3300031236 | Palsa | AQTQASERLITLQDVTFELERSQIALLRATGNLESWALGSK |
Ga0310686_1042136202 | 3300031708 | Soil | SIASERLITLQDVTFELERSQVALLRATGDLEKWAMGSK |
Ga0310813_116690891 | 3300031716 | Soil | DARTQVSERFIALQDVNFNLECSQLGLLRSTGDLEKWALGTK |
Ga0307477_109032882 | 3300031753 | Hardwood Forest Soil | DARSQASERFITLQDVTFELERSQLGVLRSTGDLEKWALGTP |
Ga0307478_113204122 | 3300031823 | Hardwood Forest Soil | QANEKLIVLQDVTFELERSQVALLRATGGLEGWALGSK |
Ga0308175_1015681683 | 3300031938 | Soil | TQFSERFIALQDVTFELQRAQLGLLRSTGELEKWALGTH |
Ga0310916_108269071 | 3300031942 | Soil | LHDLDDARAQVSERFITLQDVTFELQRAQLGLLRSTGDLEKWALGK |
Ga0311301_118079363 | 3300032160 | Peatlands Soil | SEASERFIALQDVIFELERAQLGLLRSTGDLEKWALGNP |
Ga0335085_103398111 | 3300032770 | Soil | DNARALVRERFITLQDVTFELQRAQLGLIRSTGDLEKWALGK |
Ga0335078_101255906 | 3300032805 | Soil | RTQASERFIALQDITFELERSEVGLMRSTGELEKWAMGR |
Ga0314866_081991_2_118 | 3300033807 | Peatland | RSQASEKFIALQDVTFELERAQLGLLRSTGELEKWVMR |
Ga0370515_0504031_3_131 | 3300034163 | Untreated Peat Soil | DDARSKASEHSITLEDIIFELERSQVALLRATGDLEKWAMGQ |
⦗Top⦘ |