Basic Information | |
---|---|
Family ID | F090717 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 40 residues |
Representative Sequence | AVVRIVKPRIGMGVEFIDVEAPYQGLLSRWVEQLRKSR |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.78 % |
% of genes near scaffold ends (potentially truncated) | 95.37 % |
% of genes from short scaffolds (< 2000 bps) | 87.96 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.704 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.741 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.111 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.370 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.73% β-sheet: 0.00% Coil/Unstructured: 77.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF02633 | Creatininase | 53.70 |
PF00756 | Esterase | 6.48 |
PF00378 | ECH_1 | 2.78 |
PF00873 | ACR_tran | 1.85 |
PF00440 | TetR_N | 1.85 |
PF02272 | DHHA1 | 1.85 |
PF05532 | CsbD | 0.93 |
PF07973 | tRNA_SAD | 0.93 |
PF00005 | ABC_tran | 0.93 |
PF13432 | TPR_16 | 0.93 |
PF00266 | Aminotran_5 | 0.93 |
PF06964 | Alpha-L-AF_C | 0.93 |
PF04264 | YceI | 0.93 |
PF03450 | CO_deh_flav_C | 0.93 |
PF02518 | HATPase_c | 0.93 |
PF13450 | NAD_binding_8 | 0.93 |
PF13683 | rve_3 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 53.70 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.93 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.93 |
COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.70 % |
Unclassified | root | N/A | 46.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101648057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101736578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300002917|JGI25616J43925_10342106 | Not Available | 554 | Open in IMG/M |
3300004091|Ga0062387_101611594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300005167|Ga0066672_10663692 | Not Available | 672 | Open in IMG/M |
3300005176|Ga0066679_10522221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300005176|Ga0066679_10619980 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005332|Ga0066388_101660676 | Not Available | 1128 | Open in IMG/M |
3300005576|Ga0066708_10274343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
3300005586|Ga0066691_10645431 | Not Available | 628 | Open in IMG/M |
3300005602|Ga0070762_10106657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
3300005610|Ga0070763_10805490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300005764|Ga0066903_101705760 | Not Available | 1200 | Open in IMG/M |
3300005921|Ga0070766_10294942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300006175|Ga0070712_100266281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
3300007255|Ga0099791_10016589 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
3300007255|Ga0099791_10385335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300007258|Ga0099793_10139735 | Not Available | 1143 | Open in IMG/M |
3300007265|Ga0099794_10471624 | Not Available | 659 | Open in IMG/M |
3300007265|Ga0099794_10489228 | Not Available | 647 | Open in IMG/M |
3300007265|Ga0099794_10504707 | Not Available | 637 | Open in IMG/M |
3300007788|Ga0099795_10303272 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300009038|Ga0099829_10301188 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300009038|Ga0099829_11564656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300009088|Ga0099830_10268860 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300009088|Ga0099830_10546043 | Not Available | 948 | Open in IMG/M |
3300009088|Ga0099830_10669860 | Not Available | 853 | Open in IMG/M |
3300009089|Ga0099828_11120622 | Not Available | 699 | Open in IMG/M |
3300009137|Ga0066709_101755340 | Not Available | 875 | Open in IMG/M |
3300009792|Ga0126374_10498535 | Not Available | 877 | Open in IMG/M |
3300010048|Ga0126373_13099593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300010325|Ga0134064_10213972 | Not Available | 697 | Open in IMG/M |
3300010326|Ga0134065_10334859 | Not Available | 590 | Open in IMG/M |
3300010358|Ga0126370_10792793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300010359|Ga0126376_12637917 | Not Available | 551 | Open in IMG/M |
3300010361|Ga0126378_11286204 | Not Available | 827 | Open in IMG/M |
3300011120|Ga0150983_16608143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300011269|Ga0137392_10693028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300011270|Ga0137391_11057048 | Not Available | 659 | Open in IMG/M |
3300011270|Ga0137391_11353233 | Not Available | 559 | Open in IMG/M |
3300011271|Ga0137393_10744721 | Not Available | 839 | Open in IMG/M |
3300011271|Ga0137393_11302375 | Not Available | 615 | Open in IMG/M |
3300012096|Ga0137389_10833282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300012189|Ga0137388_10581848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300012201|Ga0137365_10221840 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300012202|Ga0137363_10757393 | Not Available | 823 | Open in IMG/M |
3300012203|Ga0137399_11684310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300012209|Ga0137379_10103299 | Not Available | 2742 | Open in IMG/M |
3300012362|Ga0137361_10125364 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
3300012362|Ga0137361_11304347 | Not Available | 650 | Open in IMG/M |
3300012363|Ga0137390_11126391 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300012363|Ga0137390_11536249 | Not Available | 605 | Open in IMG/M |
3300012918|Ga0137396_10646197 | Not Available | 781 | Open in IMG/M |
3300012918|Ga0137396_10681690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300012923|Ga0137359_11306787 | Not Available | 613 | Open in IMG/M |
3300012924|Ga0137413_11160216 | Not Available | 614 | Open in IMG/M |
3300012925|Ga0137419_10653139 | Not Available | 849 | Open in IMG/M |
3300012927|Ga0137416_11654577 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012944|Ga0137410_11379264 | Not Available | 612 | Open in IMG/M |
3300012986|Ga0164304_11600906 | Not Available | 542 | Open in IMG/M |
3300012989|Ga0164305_12042547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300014166|Ga0134079_10051092 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300014201|Ga0181537_10025124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4157 | Open in IMG/M |
3300015054|Ga0137420_1326198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
3300018088|Ga0187771_11484339 | Not Available | 575 | Open in IMG/M |
3300018431|Ga0066655_10087668 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300020018|Ga0193721_1031650 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300020022|Ga0193733_1159664 | Not Available | 604 | Open in IMG/M |
3300020579|Ga0210407_10261890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1348 | Open in IMG/M |
3300020581|Ga0210399_11358418 | Not Available | 557 | Open in IMG/M |
3300020583|Ga0210401_10599349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300021046|Ga0215015_10157151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
3300021171|Ga0210405_10875219 | Not Available | 684 | Open in IMG/M |
3300021178|Ga0210408_11188078 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021407|Ga0210383_11106410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300021420|Ga0210394_10445142 | Not Available | 1140 | Open in IMG/M |
3300021477|Ga0210398_10031686 | Not Available | 4423 | Open in IMG/M |
3300021477|Ga0210398_10069943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2857 | Open in IMG/M |
3300024330|Ga0137417_1257451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
3300025939|Ga0207665_11274139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300026277|Ga0209350_1014668 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300026333|Ga0209158_1341711 | Not Available | 519 | Open in IMG/M |
3300026361|Ga0257176_1069922 | Not Available | 566 | Open in IMG/M |
3300026550|Ga0209474_10638074 | Not Available | 547 | Open in IMG/M |
3300026551|Ga0209648_10016351 | All Organisms → cellular organisms → Bacteria | 6477 | Open in IMG/M |
3300026555|Ga0179593_1175739 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300027651|Ga0209217_1087009 | Not Available | 903 | Open in IMG/M |
3300027671|Ga0209588_1208502 | Not Available | 607 | Open in IMG/M |
3300027775|Ga0209177_10234995 | Not Available | 669 | Open in IMG/M |
3300027826|Ga0209060_10471816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300027846|Ga0209180_10107824 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300027862|Ga0209701_10027320 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
3300027862|Ga0209701_10230722 | Not Available | 1090 | Open in IMG/M |
3300027875|Ga0209283_10425764 | Not Available | 863 | Open in IMG/M |
3300027895|Ga0209624_11069850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300027911|Ga0209698_10924438 | Not Available | 653 | Open in IMG/M |
3300028047|Ga0209526_10752781 | Not Available | 608 | Open in IMG/M |
3300028536|Ga0137415_10101369 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
3300028906|Ga0308309_10322951 | Not Available | 1310 | Open in IMG/M |
3300031231|Ga0170824_105908542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
3300031474|Ga0170818_101359837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031718|Ga0307474_11179083 | Not Available | 606 | Open in IMG/M |
3300031718|Ga0307474_11237224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300031747|Ga0318502_10818241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300031753|Ga0307477_10432871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
3300031754|Ga0307475_10057044 | All Organisms → cellular organisms → Bacteria | 2952 | Open in IMG/M |
3300031823|Ga0307478_10094290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 2308 | Open in IMG/M |
3300031962|Ga0307479_10103452 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.48% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1016480571 | 3300002245 | Forest Soil | LAVIRVLKPRIGMGVEFLDVEAPFDQVLFRWVEQLRRK* |
JGIcombinedJ26739_1017365781 | 3300002245 | Forest Soil | ILKPRIGMGIEFIDVEGAYHGLLCRWIETIRQSR* |
JGI25616J43925_103421061 | 3300002917 | Grasslands Soil | ALGVVRIVKPRIGMGIEFIDLDSPYHEVLRRWVEQLTKSR* |
Ga0062387_1016115942 | 3300004091 | Bog Forest Soil | DLVVEALAVVRIVKPRIGMGVEFIDVESPFDERLSRLIEQLRKSR* |
Ga0066672_106636922 | 3300005167 | Soil | LGMVRIVKPRIGMGIEFLDLEQPHYGVLHRWVEQLTKSR* |
Ga0066679_105222212 | 3300005176 | Soil | ALGVVRIVKPRVGMGVEFIDLESRHLEVLRRWVEQVTKAR* |
Ga0066679_106199801 | 3300005176 | Soil | VEALAVVRVMKPRIGMGVEFMDVEAPSNDVLFRWVEQLRKSR* |
Ga0066388_1016606762 | 3300005332 | Tropical Forest Soil | KLEALGIVRIVKPRIGMGVEFLDLEQPHYGVLRRWVEQLNKAR* |
Ga0066708_102743431 | 3300005576 | Soil | IVKPRIGMGIEFLDLEPPHHGLLCRWIEQLSKVR* |
Ga0066691_106454311 | 3300005586 | Soil | RIVKPRIGMGIEFIDLESRHLEVLRRWVEQVSKSR* |
Ga0070762_101066572 | 3300005602 | Soil | RILKPRIGMGIEFIDVEGAYHDVLNRWIDQIRQSR* |
Ga0070763_108054902 | 3300005610 | Soil | RIVKPRIGMGVEFLDVDSRYLEVLNRWIEQLRRSR* |
Ga0066903_1017057602 | 3300005764 | Tropical Forest Soil | GTVRIVKPRIGMGIEFLDLEQPHYGVLRRWVEQLSKAR* |
Ga0070766_102949423 | 3300005921 | Soil | AVVRILKPRIGMGVEFIDVESPYNEVLCRWIEQVRQSR* |
Ga0070712_1002662813 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ILKPRIGMGIEFIDIESPSHEILRRWIEQVRQAR* |
Ga0099791_100165893 | 3300007255 | Vadose Zone Soil | VRIVKPRIGMGIEFIDLESPHHEVLRRWVDQLTRSR* |
Ga0099791_103853352 | 3300007255 | Vadose Zone Soil | VVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRTR* |
Ga0099793_101397353 | 3300007258 | Vadose Zone Soil | GVVRIVKPRIGMGVEFIDVESPSDQILARWVEQLRRAR* |
Ga0099794_104716241 | 3300007265 | Vadose Zone Soil | ALGVVRIVKPRIGMGVEFIDVDAPCDQVLARWVEQLRRTR* |
Ga0099794_104892281 | 3300007265 | Vadose Zone Soil | VEALGVVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRTR* |
Ga0099794_105047071 | 3300007265 | Vadose Zone Soil | ALAVVRIVKPRIGMGVEFMDVEEPYNGVLFRWVEHLRKSR* |
Ga0099795_103032721 | 3300007788 | Vadose Zone Soil | RIVKPRIGMGIEFIDVESAGHDMLSKWIEQMRER* |
Ga0099829_103011883 | 3300009038 | Vadose Zone Soil | VVRIVKLRIGMGIEFIDVESPHHEVLRRWVDQLTRSR* |
Ga0099829_115646561 | 3300009038 | Vadose Zone Soil | RHKEQTVEALGVIRIIKPRIGIGVEFLDVEPPNDKTLVRWLEHLRKAR* |
Ga0099830_102688603 | 3300009088 | Vadose Zone Soil | RIVKPKIGMGIEFIDVESPYHEVLRRWVELLSKTR* |
Ga0099830_105460431 | 3300009088 | Vadose Zone Soil | DQKVEALAMVRIVKPRIGMGIEFIDIEAPYHDILVRWMEQLRKIR* |
Ga0099830_106698602 | 3300009088 | Vadose Zone Soil | IVKLRIGMGIEFIDVESPHHEVLRRWVDQLTKSR* |
Ga0099828_111206222 | 3300009089 | Vadose Zone Soil | QKLEALGAIRIIKPRIGMGVEFIDVEPPYDDVLCRWVEELRKNR* |
Ga0066709_1017553402 | 3300009137 | Grasslands Soil | QKVEALAVVGIVKPRIGMGVEFIDVEAPHQVLLSRWVEQLRKSR* |
Ga0126374_104985351 | 3300009792 | Tropical Forest Soil | GMVRIVKPRIGMGIEFLDLEQPHYGVLRRWVEQLSKAR* |
Ga0126373_130995931 | 3300010048 | Tropical Forest Soil | LGMVRIVKPRIGMGIEFLDLEQPHYGVLCRWVEQLSKMR* |
Ga0134064_102139721 | 3300010325 | Grasslands Soil | LAVVRIMKPRIGMGVEFMDVEPPSNDVLFRWVEQLRKSR* |
Ga0134065_103348592 | 3300010326 | Grasslands Soil | AVVRIVKPLIGMGVEFMDVEAPCNNVLFRWVEQLRKSR* |
Ga0126370_107927931 | 3300010358 | Tropical Forest Soil | IVKPRVGMGVEFIDLDATHHQTLSRWLDQLRRIR* |
Ga0126376_126379172 | 3300010359 | Tropical Forest Soil | VIRIVKARVGMGIEFLDLEPGCDEILQRWIDQLRQR* |
Ga0126378_112862042 | 3300010361 | Tropical Forest Soil | EALAMVRIVKPRIGMGVEFLDIEQPHYGMLRRWVEQVSKSR* |
Ga0150983_166081432 | 3300011120 | Forest Soil | VTFRHKEQMVEVLGVIRIVKPRIGMGVEFIDVVPPSDRTLVRWIEQLRKGR* |
Ga0137392_106930282 | 3300011269 | Vadose Zone Soil | AVVRIVKARVGMGIEFIDIESAGQDLLARWIEQLRQR* |
Ga0137391_110570482 | 3300011270 | Vadose Zone Soil | MEALAVVRIVKPRIGMGVEFMDVEAPYNNVLFRWVEQLRKSR* |
Ga0137391_113532331 | 3300011270 | Vadose Zone Soil | VEALAMVRIVKPRIGMGIEFIDVEAPYHDILVRWMEQLRKIR* |
Ga0137393_107447212 | 3300011271 | Vadose Zone Soil | VRIVKPKIGMGIEFIDVESPYHEVLRRWVELLSKTR* |
Ga0137393_113023752 | 3300011271 | Vadose Zone Soil | EALGVVRIVKLRIGMGIEFIDVESPHHEVLRRWVDQLTKSR* |
Ga0137389_108332821 | 3300012096 | Vadose Zone Soil | RIVKARVGMGIEFIDIESASHDLLARWIEQLRQR* |
Ga0137388_105818482 | 3300012189 | Vadose Zone Soil | VRIVKPRIGMGVEFIDIESAGHDLLARWIEQLRQR* |
Ga0137365_102218403 | 3300012201 | Vadose Zone Soil | IVKPRIGMGIEFIDIEAPCHDMLVRWMEQLRKIR* |
Ga0137363_107573932 | 3300012202 | Vadose Zone Soil | EALGVVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRTR* |
Ga0137399_116843102 | 3300012203 | Vadose Zone Soil | EALAVVRIVKPRIGLGIEFMDIEAPYDTVLFRWVEQLRKSR* |
Ga0137379_101032994 | 3300012209 | Vadose Zone Soil | ALGVVRVVKPRIGMGVEFIDLDSPHHEMLRRWVEQLRRSR* |
Ga0137361_101253641 | 3300012362 | Vadose Zone Soil | VEALGVVRIVKPRIGMGIEFIDLESPHHEVLRRWVDQLTRSR* |
Ga0137361_113043471 | 3300012362 | Vadose Zone Soil | MVRIVKPRIGMGIEFIDIEAPHHDMLVRWMEQLRKIR* |
Ga0137390_111263911 | 3300012363 | Vadose Zone Soil | RIVKPRIGMGIEFIDVEAAGHDMLSKWIEQMRER* |
Ga0137390_115362492 | 3300012363 | Vadose Zone Soil | IVKLRIGMGIEFIDVESPHHEVLRRWVDQLTRSR* |
Ga0137396_106461972 | 3300012918 | Vadose Zone Soil | VRIVKPRIGMGIEFIDLESPYVEVLRRWVEQLSKTR* |
Ga0137396_106816902 | 3300012918 | Vadose Zone Soil | LGVIRIVKPRIGMGVEFLDVEPPYDRVLVRWIEHLRKSR* |
Ga0137359_113067872 | 3300012923 | Vadose Zone Soil | VRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRTR* |
Ga0137413_111602161 | 3300012924 | Vadose Zone Soil | VVRIVKPRIGMGIEFIDLESPHHEVLRRWVDQLTRSR* |
Ga0137419_106531392 | 3300012925 | Vadose Zone Soil | VEALGVVRIVKPRIGMGIEFIDVDAPYHEVLRRWVEQVTKSR* |
Ga0137416_116545772 | 3300012927 | Vadose Zone Soil | VRIVKPRIGMGIEFIDIESAGHDMLSKWIEQMRER* |
Ga0137410_113792642 | 3300012944 | Vadose Zone Soil | TRKDKKVEALAVVRIVKPRIGLGIEFMDIEAPYDGVLFRWVEQLRKSR* |
Ga0164304_116009062 | 3300012986 | Soil | EALGVVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRAR* |
Ga0164305_120425471 | 3300012989 | Soil | ISLSRKEDTVEALAVVRILKPRIGMGVEFIDVDAPYHEILVRWLDQVRRSR* |
Ga0134079_100510921 | 3300014166 | Grasslands Soil | DQKLEALGTVRIVKPRIGMGIEFLDLEQPHYGVLRRWVEQLSKAR* |
Ga0181537_100251241 | 3300014201 | Bog | VVKPRIGMGVEFVDVDSPHDKLLERWILQLRRSR* |
Ga0137420_13261982 | 3300015054 | Vadose Zone Soil | VEALAVVRIVKPRIGLGIEFMDIEAPYDGVLFRWVEQLRKSR* |
Ga0187771_114843392 | 3300018088 | Tropical Peatland | EALGMVRIVKPRIGMGVELVDVEAPYNEVVNRWVEQLSKAR |
Ga0066655_100876681 | 3300018431 | Grasslands Soil | DQKVEALGVVRIVKPRVGMGVEFIDLESRYMEVLRRWVEQVTKAR |
Ga0193721_10316501 | 3300020018 | Soil | AVVRIMKPRIGMGVEFMDVEAPSNDVLFRWVEQLRKSR |
Ga0193733_11596642 | 3300020022 | Soil | RKDQSVQALAVVRIVKPRIGMGVEFIDVEVPYQGMLSRWVEQLRKSR |
Ga0210407_102618902 | 3300020579 | Soil | VRIVKPRIGMGIEFIDVEAPHHEVLARWIEQVRQSR |
Ga0210399_113584182 | 3300020581 | Soil | LGVVRIVKPRIGMGVEFIDVESPHDAVLARWVELLRKSR |
Ga0210401_105993491 | 3300020583 | Soil | AVVRILKPRIGMGVEFIDVESPYNEVLCRWIEQVRQSR |
Ga0215015_101571511 | 3300021046 | Soil | LPLKSRVRITFRHKEQTVEALGIIRIIKPRIGIGVEFIDVEPPNDKTLVRWIEHLRKTR |
Ga0210405_108752192 | 3300021171 | Soil | RIVKPRIGMGVEFLDVEPPYDEKLSRLIEQLRRAR |
Ga0210408_111880781 | 3300021178 | Soil | ALATVRIVKPRIGMGIEFIDVEAPHHEVLARWIEQVRQSR |
Ga0210383_111064102 | 3300021407 | Soil | EALAVVRILKPRIGMGIEFIDVEGAYHGLLCRWIETIRQSR |
Ga0210394_104451422 | 3300021420 | Soil | LGVVRILKPRIGMGIEFMDVEPPYHDVLRQWVDQLAKVR |
Ga0210398_100316864 | 3300021477 | Soil | AVIRVLKPRVGMGVEFLDVEGPFDQVLFRWVEQLRRK |
Ga0210398_100699434 | 3300021477 | Soil | EALAVVRILKPRIGMGVEFIDMERPYDEVLRRWLDQVRQNR |
Ga0137417_12574512 | 3300024330 | Vadose Zone Soil | VRIVKPRIGMGIEFLDVESFSLGILSRWIDQLRQR |
Ga0207665_112741391 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVRILKPRIGMGVEFIDVEAPYHEILARWLEQVRRNR |
Ga0209350_10146683 | 3300026277 | Grasslands Soil | RIVKPRIGMGIEFIDLESRHLEVLRRWVEQLTKSR |
Ga0209158_13417112 | 3300026333 | Soil | KVEALGVVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRAR |
Ga0257176_10699222 | 3300026361 | Soil | EALAVVRIVKPRIGLGIEFMDIEAPYDGVLFRWVEQLRKSR |
Ga0209474_106380742 | 3300026550 | Soil | AVVRIVKPRIGMGVEFIDVEAPYQGLLSRWVEQLRKSR |
Ga0209648_100163516 | 3300026551 | Grasslands Soil | LAVVRIVKARVGMGIEFIDIESAGQDLLARWIEQLRQR |
Ga0179593_11757393 | 3300026555 | Vadose Zone Soil | PKVEALAVVRIVKPRIGMGVEFMDVEAPYNDVLFRWVEQLRKSR |
Ga0209217_10870091 | 3300027651 | Forest Soil | LTRKEQVVEALAVVRVFKPRIGMGVEFLDVEAPFDQTLFRWVDQLRRK |
Ga0209588_12085021 | 3300027671 | Vadose Zone Soil | EALGVVRIFKPRIGMGIEFIDVDAPYHEVLRRWVEQVSKSR |
Ga0209177_102349951 | 3300027775 | Agricultural Soil | VRIVKPRIGMGIEFLDLEQPHYGVLRRWVEQLSKAR |
Ga0209060_104718162 | 3300027826 | Surface Soil | EALAVVRILKPRIGMGIEFIDVEGAYHEVLCRWIEQIRQAR |
Ga0209180_101078241 | 3300027846 | Vadose Zone Soil | VRIVKLRIGMGIEFIDVESPHHEVLRRWVDQLTRSR |
Ga0209701_100273201 | 3300027862 | Vadose Zone Soil | GVVRIVKPRIGMGIEFIDLESPHHEVLRRWVDQVSKSR |
Ga0209701_102307222 | 3300027862 | Vadose Zone Soil | GVVRIVKPRIGMGIEFIDLESPHHEVLRRWVDQLTRSR |
Ga0209283_104257641 | 3300027875 | Vadose Zone Soil | ALAMVRIVKPRIGMGIEFIDVEAPYHDILVRWMEQLRKIR |
Ga0209624_110698502 | 3300027895 | Forest Soil | LAVVRILKPRIGMGIEFIDVEGAYQELLCRWIEQIRQSR |
Ga0209698_109244381 | 3300027911 | Watersheds | LERRQQKIEALGVVRIVKPRIGMGIEFMDVEQPYHDILRQWVDQLAKGR |
Ga0209526_107527812 | 3300028047 | Forest Soil | RKDQRVEGLAVVRIVKPRIGMGVEFMDVEAPYSNVLFRWVEQLRKSR |
Ga0137415_101013694 | 3300028536 | Vadose Zone Soil | KDQKVEALGVVRIVKPRIGMGVEFIDVDAPYDQVLARWVEQLRRTR |
Ga0308309_103229511 | 3300028906 | Soil | VEALGVVRIVKPRIGMGIEFMDLEAPYVAILSRWIEQLRKSR |
Ga0170824_1059085423 | 3300031231 | Forest Soil | LAVIRVFKPRIGMGIEFLDVESPFDQTLFRWIEQLRRK |
Ga0170818_1013598371 | 3300031474 | Forest Soil | EALAVVRILKPRIGMGIEFIDVEGAYHDLLNRWIEQIRQSR |
Ga0307474_111790831 | 3300031718 | Hardwood Forest Soil | LAVIRIVKPRIGMGIEFIDVESACHDLLARWIEQLRQR |
Ga0307474_112372241 | 3300031718 | Hardwood Forest Soil | RILKPRIGMGVEFIDVESPYNEVLCRWIEQVRQSR |
Ga0318502_108182412 | 3300031747 | Soil | LGMVRIVKPHIGMGIEFLDLEQPHYNTLCRWIEQLSKVR |
Ga0307477_104328712 | 3300031753 | Hardwood Forest Soil | VRIVKPRIGMGIEFIDVESASHDLLAHWIDQLRQR |
Ga0307475_100570445 | 3300031754 | Hardwood Forest Soil | FHHKGQVVEALGVIRVVKPRIGMGVEFIDVEPPYDRTLVRWLEQLRKAR |
Ga0307478_100942901 | 3300031823 | Hardwood Forest Soil | QQMEALGTVRLVKPRVGMGIEFLDVEQPHYGVLFRWVEQLSKSR |
Ga0307479_101034523 | 3300031962 | Hardwood Forest Soil | QKVEALAVVRIVKPRIGMGVEFIDLESRHLEVLRRWVQQVSKSR |
⦗Top⦘ |