NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090768

Metagenome / Metatranscriptome Family F090768

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090768
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence MAHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA
Number of Associated Samples 89
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.33 %
% of genes near scaffold ends (potentially truncated) 26.85 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.519 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.630 % of family members)
Environment Ontology (ENVO) Unclassified
(35.185 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(78.704 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.89%    β-sheet: 0.00%    Coil/Unstructured: 52.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF01464SLT 28.70
PF02803Thiolase_C 10.19
PF02900LigB 1.85
PF07746LigA 1.85
PF00211Guanylate_cyc 1.85
PF00144Beta-lactamase 1.85
PF01266DAO 0.93
PF04392ABC_sub_bind 0.93
PF04444Dioxygenase_N 0.93
PF00872Transposase_mut 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 10.19
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.85
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.85
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.85
COG2367Beta-lactamase class ADefense mechanisms [V] 1.85
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.93
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.93
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.52 %
UnclassifiedrootN/A6.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_119985897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium836Open in IMG/M
3300002914|JGI25617J43924_10120123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium926Open in IMG/M
3300003505|JGIcombinedJ51221_10008049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3330Open in IMG/M
3300004080|Ga0062385_10161024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1171Open in IMG/M
3300004152|Ga0062386_100127468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1973Open in IMG/M
3300004631|Ga0058899_12175534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300005167|Ga0066672_10747259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300005175|Ga0066673_10028893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2644Open in IMG/M
3300005187|Ga0066675_10200034All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300005332|Ga0066388_102312812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium973Open in IMG/M
3300005363|Ga0008090_15813823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium963Open in IMG/M
3300005434|Ga0070709_10003396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales8554Open in IMG/M
3300005435|Ga0070714_100078935All Organisms → cellular organisms → Bacteria2862Open in IMG/M
3300005435|Ga0070714_102442008Not Available508Open in IMG/M
3300005436|Ga0070713_100064544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3073Open in IMG/M
3300005454|Ga0066687_10300635All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005569|Ga0066705_10030288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2901Open in IMG/M
3300005576|Ga0066708_10303083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1023Open in IMG/M
3300005587|Ga0066654_10368847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium781Open in IMG/M
3300005764|Ga0066903_107994484All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005921|Ga0070766_10004879All Organisms → cellular organisms → Bacteria → Proteobacteria6777Open in IMG/M
3300005921|Ga0070766_10100001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1716Open in IMG/M
3300006173|Ga0070716_101345224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300006175|Ga0070712_100013912All Organisms → cellular organisms → Bacteria → Proteobacteria5152Open in IMG/M
3300006755|Ga0079222_10929559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300006797|Ga0066659_10712690All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M
3300006800|Ga0066660_10542648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium976Open in IMG/M
3300009038|Ga0099829_10198995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1620Open in IMG/M
3300009792|Ga0126374_11434370Not Available564Open in IMG/M
3300010048|Ga0126373_10291905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1622Open in IMG/M
3300010048|Ga0126373_10335621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1519Open in IMG/M
3300010048|Ga0126373_10672810All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300010343|Ga0074044_10677295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300010358|Ga0126370_10487489All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300010361|Ga0126378_10492830All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300010366|Ga0126379_11507362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300010376|Ga0126381_105033111Not Available507Open in IMG/M
3300010398|Ga0126383_10803359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1024Open in IMG/M
3300012198|Ga0137364_10283276Not Available1228Open in IMG/M
3300012200|Ga0137382_10281255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1158Open in IMG/M
3300012212|Ga0150985_105187147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1915Open in IMG/M
3300012285|Ga0137370_10177490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1242Open in IMG/M
3300016294|Ga0182041_10648106All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300016319|Ga0182033_10692382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300016371|Ga0182034_10554068All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300018433|Ga0066667_11126539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300018468|Ga0066662_10263420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1419Open in IMG/M
3300018468|Ga0066662_10405779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300020579|Ga0210407_10201190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1547Open in IMG/M
3300020580|Ga0210403_10004930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria11414Open in IMG/M
3300020582|Ga0210395_10207096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1471Open in IMG/M
3300020582|Ga0210395_10714741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300020583|Ga0210401_10223078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1743Open in IMG/M
3300020583|Ga0210401_10259407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1598Open in IMG/M
3300021088|Ga0210404_10091112All Organisms → cellular organisms → Bacteria → Proteobacteria1521Open in IMG/M
3300021170|Ga0210400_10012408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales6813Open in IMG/M
3300021171|Ga0210405_11057365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300021180|Ga0210396_11007121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300021358|Ga0213873_10064552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300021362|Ga0213882_10025884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2250Open in IMG/M
3300021377|Ga0213874_10234802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300021404|Ga0210389_10068767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2714Open in IMG/M
3300021404|Ga0210389_10466592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium993Open in IMG/M
3300021405|Ga0210387_10166750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1895Open in IMG/M
3300021407|Ga0210383_10278752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1436Open in IMG/M
3300021407|Ga0210383_10537279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1009Open in IMG/M
3300021407|Ga0210383_10899990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300021420|Ga0210394_10911278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium764Open in IMG/M
3300021432|Ga0210384_10727054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium888Open in IMG/M
3300021479|Ga0210410_10078901All Organisms → cellular organisms → Bacteria → Proteobacteria2891Open in IMG/M
3300021479|Ga0210410_10321086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1389Open in IMG/M
3300021559|Ga0210409_10701981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium883Open in IMG/M
3300021560|Ga0126371_10068636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3441Open in IMG/M
3300021560|Ga0126371_10445737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1440Open in IMG/M
3300021560|Ga0126371_10536341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1319Open in IMG/M
3300021560|Ga0126371_11176337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300022498|Ga0242644_1043035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300022531|Ga0242660_1029220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1099Open in IMG/M
3300022720|Ga0242672_1010574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1108Open in IMG/M
3300022724|Ga0242665_10006315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2189Open in IMG/M
3300022724|Ga0242665_10115199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium814Open in IMG/M
3300025898|Ga0207692_10931733Not Available572Open in IMG/M
3300026322|Ga0209687_1055258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1287Open in IMG/M
3300026355|Ga0257149_1006717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1430Open in IMG/M
3300026527|Ga0209059_1016075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3395Open in IMG/M
3300026550|Ga0209474_10194611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1295Open in IMG/M
3300026551|Ga0209648_10143174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1898Open in IMG/M
3300026551|Ga0209648_10396932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium908Open in IMG/M
3300026552|Ga0209577_10143531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1885Open in IMG/M
3300027047|Ga0208730_1020074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300027069|Ga0208859_1004963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1419Open in IMG/M
3300027073|Ga0208366_1000267All Organisms → cellular organisms → Bacteria → Proteobacteria2977Open in IMG/M
3300027737|Ga0209038_10052540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1220Open in IMG/M
3300027767|Ga0209655_10158846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300027812|Ga0209656_10297962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium747Open in IMG/M
3300027824|Ga0209040_10125168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1420Open in IMG/M
3300027824|Ga0209040_10497676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031231|Ga0170824_103334791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2524Open in IMG/M
3300031474|Ga0170818_107824668Not Available974Open in IMG/M
3300031474|Ga0170818_114518312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium808Open in IMG/M
3300031543|Ga0318516_10136162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1407Open in IMG/M
3300031564|Ga0318573_10222439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1004Open in IMG/M
3300031679|Ga0318561_10331182All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300031679|Ga0318561_10762272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031912|Ga0306921_11113347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria884Open in IMG/M
3300031981|Ga0318531_10259978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium784Open in IMG/M
3300032001|Ga0306922_11597838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300032261|Ga0306920_104049465Not Available531Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.11%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil6.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027069Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11998589713300002568SoilMADAATTRLQQPLPRGTAMLSNIALSLFLWNITFRIAGLLLAT*
JGI25617J43924_1012012323300002914Grasslands SoilMAHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA*
JGIcombinedJ51221_1000804953300003505Forest SoilMTQAATTRLRQPLPLGTAXLSHIALSLLLWNLTFRIVGWLXAA*
Ga0062385_1016102423300004080Bog Forest SoilMAHAATTRLQKPLPLGTAMLLNIALSLLMWNIALRIVSLLLAT*
Ga0062386_10012746843300004152Bog Forest SoilMALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLLLAA*
Ga0058899_1217553433300004631Forest SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLAA*
Ga0066672_1074725923300005167SoilMEHVATRRLGKPLPLGTAMLSNIALSLLMWNIALRIAGLLLA*
Ga0066673_1002889333300005175SoilMAHAATTRLQEPLPPDTAILSTIALSLFLWIIALRIAGLLLAA*
Ga0066675_1020003413300005187SoilMAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA*
Ga0066388_10231281223300005332Tropical Forest SoilGNSMERVATRWLGEPLPLGTAMLCNLALSLLMWNVSLRLALMLAA*
Ga0008090_1581382313300005363Tropical Rainforest SoilMEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRIAGLLLA*
Ga0070709_1000339673300005434Corn, Switchgrass And Miscanthus RhizosphereMAHAIRTRSKEPLPLGMAMLSNIALSLFMWNLALRIVGLLFAE*
Ga0070714_10007893533300005435Agricultural SoilMQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA*
Ga0070714_10244200813300005435Agricultural SoilMERVVARRLDEPLPLSTAMLSNIALSLLMWNIALRIADLLLTA*
Ga0070713_10006454413300005436Corn, Switchgrass And Miscanthus RhizosphereMAHAATTRLQQPLPLGTAMLSNIALSLFLWNITFRIAGLLLAA*
Ga0066687_1030063523300005454SoilMKHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA*
Ga0066705_1003028813300005569SoilMAHAAITRLQEPLPLDTAMLSTIALSLFLWNIALRIAGLLLAA*
Ga0066708_1030308323300005576SoilMAHAAITRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA*
Ga0066654_1036884723300005587SoilMAHAATTRLQEPLPPDTAILSTIALSLFLWNIALRIAGLLLAA*
Ga0066903_10799448423300005764Tropical Forest SoilVEEGNPMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA*
Ga0070766_1000487933300005921SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLILVA*
Ga0070766_1010000123300005921SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLGA*
Ga0070716_10134522413300006173Corn, Switchgrass And Miscanthus RhizosphereMAHAATTRLQQPLPLGTAMLSNVALSLFLWNITFR
Ga0070712_10001391253300006175Corn, Switchgrass And Miscanthus RhizosphereMAHAATTRLQRPLPLGTAMLSNIALSLFLWNITFRIAGLLLAA*
Ga0079222_1092955923300006755Agricultural SoilMAHAATTRLQQPLPLGTAMLSNIALSLFLWNVTFRIAGLLLAA*
Ga0066659_1071269013300006797SoilKHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA*
Ga0066660_1054264823300006800SoilVKRRSLMAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA*
Ga0099829_1019899533300009038Vadose Zone SoilMSQAVIKSSEELLPLGTAVLGNLALSLLMWNIALRAAILLVRGMGTLSL*
Ga0126374_1143437013300009792Tropical Forest SoilMEHVATRRVGKSLPLGSAILFNIVLSMWIIVLRIAGLLLPA*
Ga0126373_1029190513300010048Tropical Forest SoilMERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA*
Ga0126373_1033562133300010048Tropical Forest SoilLPRAAEEGNSMERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA*
Ga0126373_1067281033300010048Tropical Forest SoilLRAALPREVEEGNPMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA*
Ga0074044_1067729523300010343Bog Forest SoilMAHAAITPLQEPLPLGMAMLSNIALSLLMWNIALRIVSLLLAA*
Ga0126370_1048748923300010358Tropical Forest SoilMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA*
Ga0126378_1049283013300010361Tropical Forest SoilATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA*
Ga0126379_1150736213300010366Tropical Forest SoilERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA*
Ga0126381_10503311113300010376Tropical Forest SoilMERVATKRLGEPLPLGTAMLSNFALSLFMWNVALRVAGLLLA*
Ga0126383_1080335923300010398Tropical Forest SoilMESVATKCLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA*
Ga0137364_1028327633300012198Vadose Zone SoilMKYVATRRLAEPLPLGTAMLSNVALSLLMWNIALR
Ga0137382_1028125513300012200Vadose Zone SoilMKYVATRRLAERLPLGTAMLSNVALSLLMWNIALRIAGLLLA*
Ga0150985_10518714713300012212Avena Fatua RhizosphereMAHAATTRLQEPLPAGTAMLSNIALSLFLWNITFRIAGLLLAA*
Ga0137370_1017749023300012285Vadose Zone SoilMEHVATRRLAKPLPLGTAMLSNIALSLFMWNIALRIAGLLLA*
Ga0182041_1064810623300016294SoilMESVATKWLGEPLPPGTAMFSNFALSLFMWNVALRLAGLLLA
Ga0182033_1069238213300016319SoilMESVATKWLGEPLPPGTAMLSNLALSLFMWNDALRLAG
Ga0182034_1055406833300016371SoilMESVATKWLGEPLPPGTAMLSNFALSLFMWNIALRLAGLLLA
Ga0066667_1112653913300018433Grasslands SoilMAHAAITRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA
Ga0066662_1026342033300018468Grasslands SoilMAHAATTGLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA
Ga0066662_1040577923300018468Grasslands SoilMEHVATRRLGKPLPLGTAMLSNIALSLLMWNIALRIAGLLLA
Ga0210407_1020119023300020579SoilMQHAAITRSHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA
Ga0210403_1000493053300020580SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVVWLLAA
Ga0210395_1020709633300020582SoilMVHGAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA
Ga0210395_1071474123300020582SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA
Ga0210401_1022307823300020583SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLAA
Ga0210401_1025940723300020583SoilMAHTAATRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA
Ga0210404_1009111233300021088SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA
Ga0210400_1001240843300021170SoilMAHAAITRLQEPMPFGTAMLSNIALSLFLWNITFRIAGLLFAA
Ga0210405_1105736513300021171SoilMANAAMTRLQQPLPLGTAMLSNIALSLLLWNIAFRVAGLLLSG
Ga0210396_1100712113300021180SoilMTQAATTRLRQPLPLGTAILSHIALSLLLWNLTFRIVGWLLAA
Ga0213873_1006455223300021358RhizosphereMAHAATTRVQEPLPLDTALLSNIALSLFLWNIAFRIAGLLLAD
Ga0213882_1002588413300021362Exposed RockMEHAVTRRSGEPLPLSTAMLSNVALSLLMWNITLRIVGLLLA
Ga0213874_1023480223300021377Plant RootsMAHAATTQVQEPLPLDTALLSNIALSLFLWNIAFRIAGLLLAD
Ga0210389_1006876713300021404SoilGAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA
Ga0210389_1046659213300021404SoilRLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA
Ga0210387_1016675033300021405SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAG
Ga0210383_1027875233300021407SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRI
Ga0210383_1053727913300021407SoilVKRSRPMQHAAITRLHEPVPLGVAMLSHIALSLFLWNITLRIVGLLLAA
Ga0210383_1089999013300021407SoilRARVKRSRPMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA
Ga0210394_1091127813300021420SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIA
Ga0210384_1072705443300021432SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIV
Ga0210410_1007890113300021479SoilHAIRIRSKEPLPLGMAMLSNIALSLFMWNLALRIVGLLFAG
Ga0210410_1032108613300021479SoilMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA
Ga0210409_1070198143300021559SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIVDW
Ga0126371_1006863663300021560Tropical Forest SoilMERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA
Ga0126371_1044573733300021560Tropical Forest SoilMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA
Ga0126371_1053634113300021560Tropical Forest SoilMEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRIAGLLLA
Ga0126371_1117633723300021560Tropical Forest SoilMEHVATRRVGKSLPLGSAILFNIVLSMWIIVLRIAGLLLPA
Ga0242644_104303523300022498SoilMVHGAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLA
Ga0242660_102922023300022531SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA
Ga0242672_101057413300022720SoilMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFA
Ga0242665_1000631533300022724SoilMQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA
Ga0242665_1011519933300022724SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIVDWLLAA
Ga0207692_1093173313300025898Corn, Switchgrass And Miscanthus RhizosphereMERVVARRLDEPLPLSTAMLSNIALSLLMWNIALRIADLLLTA
Ga0209687_105525833300026322SoilMAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRSAGLLLAA
Ga0257149_100671723300026355SoilMQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLILAA
Ga0209059_101607563300026527SoilMKHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA
Ga0209474_1019461133300026550SoilMAHAATTRLQEPLPPDTAILSTIALSLFLWIIALRIAGLLLAA
Ga0209648_1014317433300026551Grasslands SoilMAHAATTRLQKPLPLGTAMLSNIALSLFLWNITLRIAGLLFAA
Ga0209648_1039693213300026551Grasslands SoilMTHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA
Ga0209577_1014353123300026552SoilMAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA
Ga0208730_102007413300027047Forest SoilMTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLL
Ga0208859_100496323300027069Forest SoilMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA
Ga0208366_100026753300027073Forest SoilYRAKVKRSRPMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA
Ga0209038_1005254023300027737Bog Forest SoilMAHAAITPLQEPLPLGMAMLSNIALSLLMWNIALRIVSLLLAA
Ga0209655_1015884613300027767Bog Forest SoilMEYAAITRLPEPLPLGTAMLSNIALSLLMWNIALRIASLLLAA
Ga0209656_1029796223300027812Bog Forest SoilMALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLL
Ga0209040_1012516833300027824Bog Forest SoilMALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLLLAA
Ga0209040_1049767623300027824Bog Forest SoilMAQAATTRLEEPLPLGMAMLSNIALSLFMWNIALRIAGLLLAA
Ga0170824_10333479123300031231Forest SoilMAHAAITRLQEPLPLDTAMLSNIALSLLLWNIALRIAGLLLAS
Ga0170818_10782466823300031474Forest SoilMKYVATRWLAEPLPLGTALLSNVTLSLLMWNITLRIAGLLLA
Ga0170818_11451831223300031474Forest SoilMAQGAMTRSQEPLPLDTAMLSNIALSLFLWNVTLRIATLLLAA
Ga0318516_1013616223300031543SoilMESVATKWLGEPLPPGTAMLSNFALSLFMWNVALRLAGLLLA
Ga0318573_1022243913300031564SoilMESVATKWLGEPLPPGTAMLSNFALSLFMWNVALRVAGLLLA
Ga0318561_1033118213300031679SoilKWLGEPLPPGTAMLSNFALSLFMWNVALRLAGLLLA
Ga0318561_1076227223300031679SoilMAQAAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAP
Ga0306921_1111334713300031912SoilMPHAAGTRSEEPLPLGTAILSNIALSLVMWNVALR
Ga0318531_1025997813300031981SoilMESVATKWLGEPLPLGTAMLSNFALSLFIWNVALRLAGLLLA
Ga0306922_1159783813300032001SoilMAQAAITRLQEPLPLDTAMLSNIALSLFLWNIALRIGGLLLAP
Ga0306920_10404946523300032261SoilMEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRVAGLLLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.