NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090831

Metagenome / Metatranscriptome Family F090831

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090831
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 44 residues
Representative Sequence MGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ
Number of Associated Samples 96
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.83 %
% of genes near scaffold ends (potentially truncated) 87.96 %
% of genes from short scaffolds (< 2000 bps) 92.59 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.741 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.963 % of family members)
Environment Ontology (ENVO) Unclassified
(34.259 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 31.43%    Coil/Unstructured: 68.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02777Sod_Fe_C 25.00
PF13442Cytochrome_CBB3 16.67
PF02775TPP_enzyme_C 4.63
PF02445NadA 4.63
PF00753Lactamase_B 2.78
PF10012DUF2255 1.85
PF13519VWA_2 0.93
PF04199Cyclase 0.93
PF00149Metallophos 0.93
PF02663FmdE 0.93
PF00903Glyoxalase 0.93
PF00118Cpn60_TCP1 0.93
PF12796Ank_2 0.93
PF00135COesterase 0.93
PF13360PQQ_2 0.93
PF02628COX15-CtaA 0.93
PF01007IRK 0.93
PF05638T6SS_HCP 0.93
PF13531SBP_bac_11 0.93
PF10518TAT_signal 0.93
PF07519Tannase 0.93
PF14378PAP2_3 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 25.00
COG0379Quinolinate synthaseCoenzyme transport and metabolism [H] 4.63
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.93
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.93
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.93
COG2191Formylmethanofuran dehydrogenase subunit EEnergy production and conversion [C] 0.93
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.93
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.74 %
UnclassifiedrootN/A34.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002G2H8ANot Available509Open in IMG/M
3300000953|JGI11615J12901_10643577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus844Open in IMG/M
3300004157|Ga0062590_102621886All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300004801|Ga0058860_10018516Not Available527Open in IMG/M
3300005093|Ga0062594_101186142Not Available755Open in IMG/M
3300005293|Ga0065715_10713458Not Available643Open in IMG/M
3300005295|Ga0065707_10956975Not Available550Open in IMG/M
3300005295|Ga0065707_11018460All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005332|Ga0066388_105801491All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005334|Ga0068869_102043396Not Available515Open in IMG/M
3300005337|Ga0070682_101986128All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300005354|Ga0070675_100045732All Organisms → cellular organisms → Bacteria3582Open in IMG/M
3300005441|Ga0070700_100206662All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300005441|Ga0070700_100856269All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300005451|Ga0066681_10624399All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005618|Ga0068864_100183193All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300005713|Ga0066905_100840078Not Available799Open in IMG/M
3300005764|Ga0066903_103642285Not Available829Open in IMG/M
3300005843|Ga0068860_102547423All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006058|Ga0075432_10478421All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300006172|Ga0075018_10090048All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300006237|Ga0097621_101423747Not Available656Open in IMG/M
3300006358|Ga0068871_100955570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes796Open in IMG/M
3300006358|Ga0068871_101077162Not Available751Open in IMG/M
3300006755|Ga0079222_11946622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300006846|Ga0075430_101382987All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300006847|Ga0075431_101312054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia684Open in IMG/M
3300006854|Ga0075425_101559924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300006854|Ga0075425_101739662All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300006871|Ga0075434_100880446Not Available911Open in IMG/M
3300006881|Ga0068865_100117490All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300006904|Ga0075424_102864629Not Available502Open in IMG/M
3300006918|Ga0079216_11425140All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp.575Open in IMG/M
3300006954|Ga0079219_10237221All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300006954|Ga0079219_11279417Not Available643Open in IMG/M
3300007004|Ga0079218_10372104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia1202Open in IMG/M
3300007076|Ga0075435_100834983All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300009100|Ga0075418_13042241All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300009137|Ga0066709_101379599All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300009147|Ga0114129_12733999Not Available587Open in IMG/M
3300009162|Ga0075423_11322596All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009162|Ga0075423_12842027Not Available530Open in IMG/M
3300009444|Ga0114945_11046365Not Available507Open in IMG/M
3300009545|Ga0105237_11230607Not Available755Open in IMG/M
3300010045|Ga0126311_11027373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300010047|Ga0126382_12439369All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010326|Ga0134065_10264571All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300010337|Ga0134062_10458880All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300010366|Ga0126379_10790555All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300010373|Ga0134128_12944271Not Available524Open in IMG/M
3300010391|Ga0136847_13364133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300010400|Ga0134122_10490202Not Available1109Open in IMG/M
3300010400|Ga0134122_10832388All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300011416|Ga0137422_1060563All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300012203|Ga0137399_10201253All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300012353|Ga0137367_10747927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia680Open in IMG/M
3300012360|Ga0137375_10147313All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300012360|Ga0137375_11382271All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012362|Ga0137361_11585079Not Available576Open in IMG/M
3300012893|Ga0157284_10053603All Organisms → cellular organisms → Bacteria → Proteobacteria929Open in IMG/M
3300012922|Ga0137394_10984344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli701Open in IMG/M
3300012944|Ga0137410_11750721All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012957|Ga0164303_11272379Not Available543Open in IMG/M
3300014318|Ga0075351_1125408Not Available583Open in IMG/M
3300014326|Ga0157380_13069769Not Available532Open in IMG/M
3300014326|Ga0157380_13159951All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300014745|Ga0157377_10308045Not Available1048Open in IMG/M
3300014880|Ga0180082_1057484Not Available835Open in IMG/M
3300015371|Ga0132258_10021905All Organisms → cellular organisms → Bacteria13973Open in IMG/M
3300015371|Ga0132258_13456148All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300018063|Ga0184637_10123075All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1599Open in IMG/M
3300018482|Ga0066669_11278420All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300021081|Ga0210379_10175140Not Available919Open in IMG/M
3300025319|Ga0209520_10583168All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300025544|Ga0208078_1080320All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300025908|Ga0207643_10382286All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300025926|Ga0207659_10320561All Organisms → cellular organisms → Bacteria → Proteobacteria1278Open in IMG/M
3300025940|Ga0207691_11197397Not Available630Open in IMG/M
3300025942|Ga0207689_10303272All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300025945|Ga0207679_11708380Not Available576Open in IMG/M
3300025981|Ga0207640_10230292All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300026075|Ga0207708_10427916All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300026075|Ga0207708_10435119Not Available1090Open in IMG/M
3300026095|Ga0207676_10103189All Organisms → cellular organisms → Bacteria2369Open in IMG/M
3300026216|Ga0209903_1059826All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300027429|Ga0207616_101324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300027880|Ga0209481_10040914All Organisms → cellular organisms → Bacteria → Proteobacteria2126Open in IMG/M
3300027886|Ga0209486_10273253All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300027909|Ga0209382_11470349All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300028380|Ga0268265_11789797All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300028799|Ga0307284_10237433All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300031152|Ga0307501_10124096All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031421|Ga0308194_10336567All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031562|Ga0310886_10900564Not Available562Open in IMG/M
3300031720|Ga0307469_10309584All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300031847|Ga0310907_10249132All Organisms → cellular organisms → Bacteria → Proteobacteria873Open in IMG/M
3300031854|Ga0310904_10508415Not Available809Open in IMG/M
3300031854|Ga0310904_11081819Not Available574Open in IMG/M
3300031943|Ga0310885_10476925All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300031944|Ga0310884_10755308Not Available592Open in IMG/M
3300032012|Ga0310902_10400772All Organisms → cellular organisms → Bacteria → Proteobacteria873Open in IMG/M
3300032075|Ga0310890_10043985All Organisms → cellular organisms → Bacteria → Proteobacteria2511Open in IMG/M
3300032144|Ga0315910_11150946All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300032174|Ga0307470_11216146Not Available613Open in IMG/M
3300032180|Ga0307471_102646135Not Available636Open in IMG/M
3300033433|Ga0326726_10587162All Organisms → cellular organisms → Bacteria1070Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.93%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026216Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)EnvironmentalOpen in IMG/M
3300027429Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_106708002170459003Grass SoilIVLNWTGALKGDEIAFTRGMDGGQGQTQQFTAKRQK
JGI11615J12901_1064357723300000953SoilDGTIDKTNIKFKTTQQGRGGEVTFEWTGTLKGDELAMKRMATGREGAPQEFTLKREK*
Ga0062590_10262188613300004157SoilDLKFKTKQQGRGGEVILTWTGTLKGDEIAFSRMPEGGQAVMFTAKRQK*
Ga0058860_1001851623300004801Host-AssociatedKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ*
Ga0062594_10118614223300005093SoilGRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ*
Ga0065715_1071345823300005293Miscanthus RhizosphereMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ*
Ga0065707_1095697523300005295Switchgrass RhizosphereRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ*
Ga0065707_1101846023300005295Switchgrass RhizosphereQGRGGEVTFEWSGTLKGDEIAMKRSVAGREGAPQEFTLKREK*
Ga0066388_10580149113300005332Tropical Forest SoilKQMGRGGEVTLNWSGTLKGDEIAFTRMQDGGQGQPQEFTLKRMQ*
Ga0068869_10204339613300005334Miscanthus RhizosphereGMLKFKTKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK*
Ga0070682_10198612823300005337Corn RhizosphereLKFKTTQQGRGGEVTFEWTGTLKGDEIAMKRSVEGREGGPQEFTLKRQ*
Ga0070675_10004573243300005354Miscanthus RhizosphereVTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ*
Ga0070700_10020666243300005441Corn, Switchgrass And Miscanthus RhizosphereMLKFKTKQMGRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ*
Ga0070700_10085626923300005441Corn, Switchgrass And Miscanthus RhizosphereVTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ*
Ga0066681_1062439913300005451SoilGGEVTLNWSGTLKGDEIAFTRAQEGGQGQPVEFTLKREK*
Ga0068857_10107218923300005577Corn RhizosphereANNALKFVTHQMGRGGQVTFNWDGTLKGDEIAMKRAVEGREGGPQEFTLKRQ*
Ga0068864_10018319313300005618Switchgrass RhizosphereQMGRGGEVVMSWAGTLKGDEIAFSRTPEGGQAQTFTAKRQK*
Ga0066905_10084007823300005713Tropical Forest SoilGEVTLNWSGALKGDEIAFTRMQDGGQGQPQEFTLKRMQ*
Ga0066903_10364228523300005764Tropical Forest SoilAEVTMSWSGTVKGDEIAMTRTVEGGQGQSQEFTLKRQK*
Ga0068860_10254742313300005843Switchgrass RhizosphereGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ*
Ga0068862_10087122133300005844Switchgrass RhizosphereISGSALKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK*
Ga0075432_1047842113300006058Populus RhizosphereIEKTALKFKTTQQGRGGQVTFNWSGTLKGDEIAMSRAAEGGQGQTQEFVLKRQP*
Ga0075018_1009004823300006172WatershedsFKTKQQGRGGEVVFSWTGTVKGDEIAFSRTPEGGQAQTFTAKRQK*
Ga0097621_10142374713300006237Miscanthus RhizosphereLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK*
Ga0068871_10095557013300006358Miscanthus RhizosphereMGRGGEINLSWSGTVKGDEIAMTRTVEGGQGQSQEFTLKRQK*
Ga0068871_10107716223300006358Miscanthus RhizosphereISGSTLKFKTKQMGRGGEVVLNWTGTVKGDEIAFTRGAEGATPVEFTVKRSKE*
Ga0079222_1194662223300006755Agricultural SoilNMLKFKTTQQGRGGEITLTWTGTLKGDEIAFSRMPEGGQAQEFVLKRK*
Ga0075430_10138298713300006846Populus RhizosphereTKQQGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK*
Ga0075431_10131205433300006847Populus RhizosphereGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK*
Ga0075425_10155992413300006854Populus RhizosphereGEINISWSGTVKGDEIAMTRTIEGGQGQPQEFTLKRQK*
Ga0075425_10173966223300006854Populus RhizosphereMGRGGEVTVSWSGRINGEVPEIVMKRTVEDGQGQPQEFTLKRQQP*
Ga0075434_10088044613300006871Populus RhizosphereGGEVTLNWSGTLKGDEIAFTRMAEGGQGEPQQFTLKRMQ*
Ga0068865_10011749013300006881Miscanthus RhizosphereGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMQ*
Ga0075424_10286462913300006904Populus RhizosphereKFKTTQMGRGGNEVNMSWSGTLKGDEIAMTRTVEGGQGQPQEFTLKRQK*
Ga0079216_1142514033300006918Agricultural SoilTLNWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK*
Ga0079219_1023722113300006954Agricultural SoilGEVTLNWTGTLKGDEIAFTRMAEGGQGQAQEFTLKRQN*
Ga0079219_1127941713300006954Agricultural SoilLNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ*
Ga0079218_1037210413300007004Agricultural SoilALKFKTQQQGRGGNQITLDWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK*
Ga0075435_10083498323300007076Populus RhizosphereGGEVTLNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ*
Ga0075418_1304224113300009100Populus RhizosphereGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK*
Ga0066709_10137959913300009137Grasslands SoilRGGQVTYSWTGTVKGDEIAFSRTPEGGQAQQFTAKRQKS*
Ga0114129_1273399923300009147Populus RhizosphereALKFKTTQQGRGGQVTFSWSGPLKGDEIAMSRMAEGGQGQNQEFVLKRQP*
Ga0075423_1132259623300009162Populus RhizosphereMGRGGNEVTLNWSGTVKGDEIAMTRAIEGGQGQSQELTLKRQK*
Ga0075423_1284202713300009162Populus RhizosphereTLNWSGTLKGDEIAFSRMAEGGQGEPQQFTLKRMQ*
Ga0114945_1104636523300009444Thermal SpringsLSYAGTLKGDEIAFKRMAEGGQGQSQDFVAKRQK*
Ga0105237_1123060713300009545Corn RhizosphereKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRMK*
Ga0126311_1102737323300010045Serpentine SoilQMGRGGEIVFNWTGTVKGDEIAFSRMAEGGQGQAQEFSLKKQK*
Ga0126382_1243936913300010047Tropical Forest SoilTQQGRGGEVTMEWTGTLKGDEIAMKRSVAGREGAPQEFTLKREK*
Ga0134065_1026457123300010326Grasslands SoilLNWSGTLKGYEIAFTRAQEGGQGQPVEFTLKREK*
Ga0134062_1045888013300010337Grasslands SoilSKQMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRQK*
Ga0126379_1079055513300010366Tropical Forest SoilKIAFKSTQMGRGGEINLSWSGTLKGDEIAMTRAVEGGQGQSQEFTLKRQK*
Ga0134128_1294427113300010373Terrestrial SoilQMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPMEFTLKRQK*
Ga0136847_1336413313300010391Freshwater SedimentQQGRGGEVTMSWSGTVKGDEIAFSRMVEGGQGQAQEFTLKRQK*
Ga0134122_1049020213300010400Terrestrial SoilKSVQQGRGGQVTMNWAGTVKGDEIAFTRTPEGGQAVEFTAKRQK*
Ga0134122_1083238823300010400Terrestrial SoilLKFKTKQMGRGGEVTLDWSGTLKGDEIAFTRMAEGGQGQPMEFTLKRQK*
Ga0137422_106056313300011416SoilFKTQQQGRGGTPVTLNWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK*
Ga0137399_1020125333300012203Vadose Zone SoilGEVTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRQQ*
Ga0137367_1074792723300012353Vadose Zone SoilKQMGRGGEIMMAWAGTLKGDEIAFTRTPEGGQAQTFTAKRQK*
Ga0137375_1014731333300012360Vadose Zone SoilNGMLKFKTKQMGRGGEVTLAWSGTLKGDEIAFTRMAEGGQGQPMEFTLKREK*
Ga0137375_1138227113300012360Vadose Zone SoilGRGGEVTFEWTGTLKGDELAMKRMATGREGAPQEFTLKREK*
Ga0137361_1158507923300012362Vadose Zone SoilKSKQMGRGGEVTLNWSGTLKGDEIAFTRAQEGGQGQPVEFTLKREK*
Ga0157284_1005360333300012893SoilKFKTKQMGRGGEVVFNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK*
Ga0137394_1098434413300012922Vadose Zone SoilTKQMGRGGEVTLNWSGTLKGSEIAFTRMAEGGQGQPVEFTLKRQ*
Ga0137410_1175072113300012944Vadose Zone SoilLKFKSTQMGRGGEINMSWSGTLTGDEIAFTRTIEGGQGQSQEFTLKRQK*
Ga0164303_1127237923300012957SoilGMLKFKTKQMGRGGEVTLNWSGTLKGDEIAFSRMAEGGQGEQQQFTLKRMQ*
Ga0075351_112540813300014318Natural And Restored WetlandsGRGGGAPVTLNWSGILKGDEIAMSRMAEGGQGQAQEFVLKRQK*
Ga0157380_1306976923300014326Switchgrass RhizosphereNQVTLNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK*
Ga0157380_1315995123300014326Switchgrass RhizosphereSGSDLKFKTKQQGRGGEVILTWTGTLKGDEIAFSRMPEGGQAVMFTAKRQK*
Ga0157377_1030804513300014745Miscanthus RhizosphereMGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ*
Ga0180082_105748423300014880SoilGRGGEITLDWSGALKGDEIAFTRMAEGGQGQPQEFTLKRQQ*
Ga0132258_10021905183300015371Arabidopsis RhizosphereLNWAGTLKGDEIAMSRMAEGGQGQAQEFVLKRQPWTSY*
Ga0132258_1345614833300015371Arabidopsis RhizosphereLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ*
Ga0184637_1012307513300018063Groundwater SedimentRVRRGVQQQGRGGGAPVTLNWTGTLKGDEIAMSRMPEGGQAVDFVLKRQK
Ga0066669_1127842013300018482Grasslands SoilVTYSWTGTVKGDEIAFSRTPEGGQAQQFTAKRQKS
Ga0210379_1017514023300021081Groundwater SedimentGGALKFKTQQQGRGGGAPVTLNWSGTLKGDEIAMTRMAEGGQGQAQEFVLKRQK
Ga0209520_1058316823300025319SoilQQQGRGGQVTFNWSGTLKGDEIAMSRMAEGGQGQAQEFVLKRQK
Ga0208078_108032013300025544Arctic Peat SoilMGRGGEIVLSWTGTLKGDEIAFSRTPEGGQAQTFTAKRQK
Ga0207643_1038228623300025908Miscanthus RhizosphereVTHQKGRGGQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTRKRQ
Ga0207659_1032056113300025926Miscanthus RhizosphereGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK
Ga0207691_1119739713300025940Miscanthus RhizosphereNALKFVTHQMGRGGEVTFNWDGTLKGDEIAMKRSVEGREGGPQEFTLKRQ
Ga0207689_1030327233300025942Miscanthus RhizosphereKFKTTQQGRGGEVVFEWTGTLKGDEIAMKRMVTGREGQPQEFTLKREK
Ga0207679_1170838023300025945Corn RhizosphereMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ
Ga0207640_1023029213300025981Corn RhizosphereVTLNWSGTLKGDEIAFTRMAEGGQGQPQEFTLKRMQ
Ga0207708_1042791613300026075Corn, Switchgrass And Miscanthus RhizosphereMLKFKTKQMGRGGEITLNWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQQ
Ga0207708_1043511913300026075Corn, Switchgrass And Miscanthus RhizosphereLKFVTHQMGRGGQVTFNWDGTLKGDEIAMKRAVEGREGGPQEFTLKRQ
Ga0207676_1010318913300026095Switchgrass RhizosphereGADLKFKTKQMGRGGEVVMSWAGTLKGDEIAFSRTPEGGQAQTFTAKRQK
Ga0209903_105982623300026216SoilFKTKQMGRGGEIVLNWTGTLKGDEIAFSRMAEGGQGQAQTFTAKRQK
Ga0207616_10132413300027429SoilFKTKQMGRGGEVTLNWSGTLKGDEIAFTRMADGGQGQPQEFTLKRMQ
Ga0209481_1004091433300027880Populus RhizosphereGSALKFKTKQMGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK
Ga0209486_1027325313300027886Agricultural SoilALKFKTQQQGRGGNQITLDWSGTLKGDEIAMSRKAEGGEGQAQEFTLKREK
Ga0209382_1147034933300027909Populus RhizosphereQQGRGGEITLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRAK
Ga0268265_1178979723300028380Switchgrass RhizosphereMGRGGNEVNMSWSGTVKGDEIAMTRTIEGGQGQAQEFTLKREK
Ga0307284_1023743313300028799SoilKFKSKQMGRGGEVTLNWSGTLKGDEIAFTRMAEGGQGQPVEFTLKREK
Ga0307501_1012409623300031152SoilMLKFKTKQMGRGGEITLDWSGTLKGDEIAFTRMAEGGQGQAQEFTLKRQ
Ga0308194_1033656713300031421SoilNIKFKSKQQGRGGEVVMTWTGTLKGDEIAFSRQPEGGQAVEFTAKRQK
Ga0310886_1090056423300031562SoilVTLNWSGTLKGDEIAMSRKAEGGEGAAQEFVLKREK
Ga0307469_1030958413300031720Hardwood Forest SoilANGTLKFRTKQMGRGGEITLNWSGILKGDEIAFTRMAEGGQGQPQEFTLKRQQ
Ga0310907_1024913233300031847SoilLKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK
Ga0310904_1050841513300031854SoilGGQITFNWDGTLKGDEIAMKRSVEGREGGPQEFTLKRQ
Ga0310904_1108181913300031854SoilEVTLDWSGALKGDEIAFTRMAEGGQGQPQEFTLKRQ
Ga0310885_1047692533300031943SoilTLNWSGTLKGDEIAMSRKAEGGEGQAQDFTLKREK
Ga0310884_1075530823300031944SoilQVTFNWDGMLKGDEIAMKRSVEGREGGPQEFTLKRQ
Ga0310902_1040077213300032012SoilALKFKSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK
Ga0310890_1004398513300032075SoilSKQMGRGGEIVLNWTGTLKGDEIAMSRMAEGGQGQAQEFTLKRQK
Ga0315910_1115094613300032144SoilKTKQQGRGGNEITLNWAGTLKGDEIAMSRMADGGQGQAQEFTLKREK
Ga0307470_1121614623300032174Hardwood Forest SoilEASLSGSTVKFKTKQMGRGGEVILNWTGTVKGEEIAFSRMAEGGQGQAQEFTLKKQK
Ga0307471_10264613523300032180Hardwood Forest SoilITLNWSGALKGDEIAFTRMAEGGQGQAQEFTLKRQQ
Ga0326726_1058716213300033433Peat SoilGRGGEVTLNWSGTLKGDEIAFTRAQDGGQGQPVEFTLKREK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.