NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090877

Metagenome / Metatranscriptome Family F090877

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090877
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 71 residues
Representative Sequence MFFYISGMGATFFNTESKGFGIFVGDKILRLLVPFVLAIFIFLIPRLYFGQQYEDFTRPDGKIEEDYW
Number of Associated Samples 91
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 26.17 %
% of genes near scaffold ends (potentially truncated) 50.00 %
% of genes from short scaffolds (< 2000 bps) 99.07 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.222 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(15.741 % of family members)
Environment Ontology (ENVO) Unclassified
(45.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.593 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.08%    β-sheet: 0.00%    Coil/Unstructured: 47.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001263|BBAY83_10071497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1132Open in IMG/M
3300002835|B570J40625_100283635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1694Open in IMG/M
3300002835|B570J40625_101246496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300004767|Ga0007750_1476707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1410Open in IMG/M
3300004793|Ga0007760_11293566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1208Open in IMG/M
3300004796|Ga0007763_10013407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Muricauda → Muricauda ruestringensis512Open in IMG/M
3300004836|Ga0007759_11428634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1496Open in IMG/M
3300005516|Ga0066831_10028704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1509Open in IMG/M
3300005662|Ga0078894_10275760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1526Open in IMG/M
3300006164|Ga0075441_10122471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum990Open in IMG/M
3300006383|Ga0075504_1323560All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300007513|Ga0105019_1187568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1036Open in IMG/M
3300007558|Ga0102822_1093589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300007624|Ga0102878_1246949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300007642|Ga0102876_1171273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300008958|Ga0104259_1035717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300008993|Ga0104258_1031606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum993Open in IMG/M
3300008993|Ga0104258_1086017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300008993|Ga0104258_1103393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009025|Ga0103707_10073504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300009071|Ga0115566_10276417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum997Open in IMG/M
3300009080|Ga0102815_10505916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300009080|Ga0102815_10824789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300009154|Ga0114963_10496187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300009193|Ga0115551_1340773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300009432|Ga0115005_10170230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1692Open in IMG/M
3300009436|Ga0115008_10570259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300009437|Ga0115556_1219014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300009445|Ga0115553_1284397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300009466|Ga0126448_1015566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1857Open in IMG/M
3300009466|Ga0126448_1073908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300009507|Ga0115572_10555849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300009544|Ga0115006_10430846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1155Open in IMG/M
3300009592|Ga0115101_1117644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1650Open in IMG/M
3300009599|Ga0115103_1376367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300009606|Ga0115102_10050516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300009606|Ga0115102_10774811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1417Open in IMG/M
3300009677|Ga0115104_10545050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum878Open in IMG/M
3300009677|Ga0115104_10626556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300009677|Ga0115104_11136727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300009679|Ga0115105_10024136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300010354|Ga0129333_10230521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1676Open in IMG/M
3300010370|Ga0129336_10625548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300010370|Ga0129336_10644818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300010883|Ga0133547_10963920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1655Open in IMG/M
3300010970|Ga0137575_10055208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300012414|Ga0138264_1085232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300012418|Ga0138261_1098905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300012419|Ga0138260_10539309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300012504|Ga0129347_1023474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300012718|Ga0157557_1195463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300012954|Ga0163111_11463026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300012966|Ga0129341_1330878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300016703|Ga0182088_1019076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300018692|Ga0192944_1057688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018846|Ga0193253_1016354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1615Open in IMG/M
3300019045|Ga0193336_10575578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300019283|Ga0182058_1258710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300019459|Ga0181562_10434068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300020083|Ga0194111_10351589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum993Open in IMG/M
3300020084|Ga0194110_10228165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1378Open in IMG/M
3300020220|Ga0194119_10724590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300021169|Ga0206687_1057504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1202Open in IMG/M
3300021359|Ga0206689_10805384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300021378|Ga0213861_10471686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300021941|Ga0063102_1044666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1572Open in IMG/M
3300021962|Ga0222713_10282079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1067Open in IMG/M
3300025508|Ga0208148_1034801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1332Open in IMG/M
3300025626|Ga0209716_1144359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300025822|Ga0209714_1126949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300025880|Ga0209534_10475154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300025887|Ga0208544_10405496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300026182|Ga0208275_1036140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1012Open in IMG/M
3300026420|Ga0247581_1081685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300026448|Ga0247594_1011067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1399Open in IMG/M
3300026448|Ga0247594_1024514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum999Open in IMG/M
3300026462|Ga0247568_1023070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1173Open in IMG/M
3300026465|Ga0247588_1035088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum975Open in IMG/M
3300026495|Ga0247571_1012428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1697Open in IMG/M
3300026500|Ga0247592_1039272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1155Open in IMG/M
3300026513|Ga0247590_1202706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300027192|Ga0208673_1067618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300027753|Ga0208305_10304706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300027771|Ga0209279_10165297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300027833|Ga0209092_10472583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300027833|Ga0209092_10506492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300027849|Ga0209712_10585759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300027899|Ga0209668_10077031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1880Open in IMG/M
3300027899|Ga0209668_11180232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300028137|Ga0256412_1039410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1602Open in IMG/M
3300028137|Ga0256412_1341638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300028595|Ga0272440_1081933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1208Open in IMG/M
3300030788|Ga0073964_10001156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300030788|Ga0073964_10013802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1626Open in IMG/M
3300031569|Ga0307489_11370470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300031579|Ga0308134_1083823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300031710|Ga0307386_10707490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300031729|Ga0307391_10118229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1303Open in IMG/M
3300031729|Ga0307391_10474447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300031784|Ga0315899_10374393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1391Open in IMG/M
3300031784|Ga0315899_11177732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300032519|Ga0314676_10675981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300032522|Ga0314677_10733937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300033572|Ga0307390_11036553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300034022|Ga0335005_0435455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300034060|Ga0334983_0190339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1278Open in IMG/M
3300034060|Ga0334983_0672930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.04%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.19%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.63%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.63%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water4.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.78%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.78%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.78%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.85%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.85%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.93%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.93%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.93%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012710Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012718Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY83_1007149723300001263Macroalgal SurfaceMGIPMFFYISGMSATFFNTERKGFGQFFYDKTLRLMLPFVLAIFIFLMPRLYYGQPYEDWTRPDKKNIENDYWEF*
B570J40625_10028363523300002835FreshwaterMFFYISGMASTFFNSEGKGFGMFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
B570J40625_10124649623300002835FreshwaterMGIPMFFYVSGMASTYFNTEGKGFGIFVGDKTLRLLVPFVLAIFIFLIPRLYFGQAYEDFTRPDG*
Ga0007750_147670723300004767Freshwater LakeMFFYISGMASTYFNSEGKGFGLFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
Ga0007760_1129356613300004793Freshwater LakeKKDGIIKSLVQIGIPMFFYISGMASTYFNSEGKGFGLFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
Ga0007763_1001340713300004796Freshwater LakeMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNYWSFMEKTLP
Ga0007759_1142863423300004836Freshwater LakeMFFYISGMASTYFNSEGKGFGMFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
Ga0066831_1002870433300005516MarineMFFYISGMGATFFNTEGKGFGIFVGNKCLRLLIPFVVAIFVFLIPRLYFGQSYEDFTRPDGKTEDDYW*
Ga0078894_1027576023300005662Freshwater LakeMFFYISGMASTFFNSEGKGFGMFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
Ga0075441_1012247133300006164MarineMFFYISGMGATFFNTESKGFGIFVGDKILRLLVPFVLAIFIFLIPRLYFGQQYEDFTRPDGKIEEDYW*
Ga0075504_132356013300006383AqueousMFFYISGMGATFFNTEKKGFGTFFVDKIARLMIPFVLAIFIFLIPRLYFGQPYEDWTRPDKKNMENDYWDF*
Ga0105019_118756823300007513MarineMFFYISGIGATFFNTEGKGFGIFVWDKILRLMIPFVFAIFIFLIPRLYFGQPYEEFCRPDGVMENDYWVF*
Ga0102822_109358923300007558EstuarineMFFYISGMGATYFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDKVHMENDYWEFNKQILPGIFSRL
Ga0102878_124694923300007624EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNVENDYWTFQMNTLPK
Ga0102876_117127313300007642EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNVENDYWT
Ga0104259_103571713300008958Ocean WaterMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIP
Ga0104258_103160613300008993Ocean WaterMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQQFEDWCRPNGDNGESENDYFAF*
Ga0104258_108601723300008993Ocean WaterGMGSTFFNTEGKGFGIFVGDKLLRLMVPFVLAIFIFLIPRLYYGQPYEEFCRPDGKHIENDYWEF*
Ga0104258_110339313300008993Ocean WaterMFFYISGMGATYFNTEGKGFGNFVGNKVLRLLVPFVVAVFIFLIPRLYFGQQYEDFCRPNGKDIEE
Ga0103707_1007350423300009025Ocean WaterMAASPATTFQKRWKRAAMAATFFSTEGRGFGLFLGDKALRLLLPFVIAVFIFLIPRLYFGQEYEDFTRPDGKTETDYWEF*
Ga0115566_1027641733300009071Pelagic MarineMFFYISGIGSTFFKTEEKNFGIFVGDKVLRLLIPFIVAIFVFLIPRLYFGQQYEDFTRPDDQIESNYWEYMKKMLP
Ga0102815_1050591613300009080EstuarineMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFFIAIFVFLIPRLYFGQSYEDFCKPDGKNV
Ga0102815_1082478913300009080EstuarineMFFYISGIGATFFKTEEKNYGVFVGDKVLRLLVPFVVAIFVFLIPRLYFGQQYEDFTRPDDQIESNYWTYM
Ga0114963_1049618713300009154Freshwater LakeMFFYISGMASTFFNSEGKGFGMFVVDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF*
Ga0115551_134077313300009193Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQQFEDWCRPNGDNGESENDYF
Ga0115005_1017023023300009432MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEWCRYDKKT*
Ga0115008_1057025913300009436MarineMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEWCRYDKKT*
Ga0115556_121901413300009437Pelagic MarineMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFVIAIFVFLIPRLYFGQSYEDFCKPDGKNVEE
Ga0115553_128439713300009445Pelagic MarineMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFILLIPRLYFGQQYEDFTRPNGKVEEDYW
Ga0126448_101556643300009466Meromictic PondMFFYISGIGSTFFNTERDHYGIFVGGKVLRLLVPFIVAIFVFLIPRLYFGQQYEDFTRPDDKIENDYWLFM*
Ga0126448_107390813300009466Meromictic PondMFFYISGIGSTFFNTERDHYGIFVGGKVLRLLVPFVVAIFVFLIPRLYFGQQYEDFTRPNDKIENDYWLFM*
Ga0115572_1055584923300009507Pelagic MarineMFFYISGMAATFFNTEGKGFGIFFYDKCLRILLPFIVGIFVFLMPRIYLGQQYEDWCRPDGEIENDYWQFQMKTLPSIA
Ga0115006_1043084623300009544MarineMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVVAIFIFLIPRLYFGQPYEEWCRYDKKT*
Ga0115101_111764413300009592MarineMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLLVPFVLAIFIFLIPRLYFGQQYEDWCRPDENNGESENDYWTF*
Ga0115103_137636713300009599MarineMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKKTEVGDYW
Ga0115102_1005051613300009606MarineMFFYISGMGSTFFNTEGKGFGNFVGNKTLRLMVPFIVAIFIFLIPRLYFGQQYEDFCRPNGKDIEDDYWTFQTKTLQGNIFIKLSWL
Ga0115102_1077481113300009606MarineKDGIIKCLVQIGIPMFFYIAGMGATFYNTEGKGFGNFVGNKTLRLIVPFCIAIFVFLIPRLYFGQSYEDFTRPDGKQEDDYWQF*
Ga0115104_1054505013300009677MarineMFFYISGMGATFFNTEGKGFGNFVGNKVLRLMVPFVIAIFIFLIPRLYFGQQYEDFCRPNGKDIEEDYWTFQTKTL*
Ga0115104_1062655613300009677MarineMFFYLSGIGATFFRTEDKNFAIFVGEKALRLLVPFVVAIFVFLIPRLYFGQQYEDFTRPDDVIENDYWLFMQKTLP
Ga0115104_1113672713300009677MarineMFFYISGMGATFFNTEGKGFGNFVGNKVLRLLVPFVIAIFIFLIPRLYFGQQYEDFCRPNGKDIEEDYWTFQTKTLQ
Ga0115105_1002413623300009679MarineVQIGIPMFFYISGIGATFFDTEKNHFGIFVGGKVLRLLVPFIVAIFVFLIPRLYFGQQYEDYTRPNDEIENDYWEFMKKTLP
Ga0129333_1023052123300010354Freshwater To Marine Saline GradientMFFYISGAASTFFNTEGKGFGIFLGDKILRLMVPFVVAIFIFLIPRLYFGQEYEDWTRPGGETEPDYWKF*
Ga0129336_1062554813300010370Freshwater To Marine Saline GradientMFFYISGAASTFFNTEGKGFGIFLGDKILRLMVPFVVAIFIFLIPRLYFGQEYEDWTRPGGETEPDYWK
Ga0129336_1064481813300010370Freshwater To Marine Saline GradientMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKHVE
Ga0133547_1096392023300010883MarineMFFYISGMGATFFNTEGKGFGIFFWDKCLRILIPFIIAIFVFLIPRIYLGQQYEDWCRPDGEIENDYW*
Ga0137575_1005520813300010970Pond Fresh WaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNYWS
Ga0138264_108523223300012414Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMVPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNM
Ga0138261_109890513300012418Polar MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLMIPFVIAIVVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIPGI
Ga0138260_1053930913300012419Polar MarineMFFYVSGIGSTFFRTEDKHFGIFVGDKVLRLLVPFIMAIFIFLIPRLYFGQQYEDWTRPNDKIENNYWEFLQ*
Ga0129347_102347413300012504AqueousMFFYISGMGATFFNTEGKGFGNFVGNKVLRLMVPFVIAIFIFLIPRLYFGQQYEDFCRPNGKDIEDDYWTFQTKTL*
Ga0157550_121397523300012710FreshwaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNYWSFMEKTLPTIHLKLSW
Ga0157557_119546323300012718FreshwaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNYWSFMEK
Ga0163111_1146302623300012954Surface SeawaterMFFYISGMGATFFNTEGKGFGNFVGNKVLRLMVPFVIAIFIFLIPRLYFGQQYEDFCRPDGKTIEDDYWTF
Ga0129341_133087823300012966AqueousMFFYISGMGATYFNTEGKGFGNFVGNKTLRLIVPFIIAIFIFLIPRLYFGQSYEDFCRPDGKQEDD
Ga0182088_101907613300016703Salt MarshMFFYISGIGSTFFDTEKKHFGIFVGDKVLRLLVPFVVAIFVFLIPRLYFGQTYEDYTRPNDEIENDYWEFMKK
Ga0192944_105768813300018692MarineMFFYVSGIGATFFRTEDKHFGIFVGDKVLRLLVPFVIAIFVFLIPRLYFGQPYEEWTRPNEKME
Ga0193253_101635413300018846MarineMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLLVPFVLAIFIFLIPRLYFGQQYEDWCRPDENNGESENDYWTF
Ga0193336_1057557813300019045MarineMFFYISGIGASFFDTEKNHYGIFVGGKVLRILIPFVIAIFVFLIPRLYFGQQYEDFTRVDGEIQSNYWEYMKA
Ga0182058_125871023300019283Salt MarshMFFYISGMGATFFNTEGKGFGNFVGNKVLRLMVPFVIAIFIFLIPRLYFGQQYEDFCRPNGKDIEEDYWTFQTKTL
Ga0181562_1043406813300019459Salt MarshMFFYISGIGSTFFNTEKNHYGIFVGGKVLRLLVPFVVAIFVFLIPRLYFGQQYEDFTRPD
Ga0194111_1035158923300020083Freshwater LakeMFFYISGMASTFFNSEGKGFGMFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0194110_1022816533300020084Freshwater LakeMFFYISGMASSFFNSEGKGFGMFVADKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0194119_1072459013300020220Freshwater LakeMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNYWSFMEKTLPTI
Ga0206687_105750423300021169SeawaterMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEWCRYDKKT
Ga0206689_1080538423300021359SeawaterMFFYISGMGSTFFNTEGKGFGIFFFDKVLRLVVPFILAIFIFLIPRLYYGQPYEDWCRPDKKNIEN
Ga0213861_1047168613300021378SeawaterMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFVIAIFVFLIPRLYFGQSYEDFCKPDGKNVEEDYWTFQMKTLPTIGSKLS
Ga0063102_104466623300021941MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEWCRYDKKT
Ga0222713_1028207923300021962Estuarine WaterMFFYISGMGATFFNTEGKGFGNFVGNKTLRLMVPFVIAIFIFLIPRLYFGQSYEDFTRPGGVQEDDYWTF
Ga0208148_103480133300025508AqueousIKCLVQIGIPMFFYISGMGATFFNTEGKGFGIFVWDKILRLAIPFVVAIFVFLIPRLYFGQLYEDWTRPNG
Ga0209716_114435913300025626Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQQFEDWCRPNGD
Ga0209714_112694923300025822Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQQFEDWCRPNGDNGESENDYFAFQSKTLP
Ga0209534_1047515423300025880Pelagic MarineMFFYISGMAMTFYNTEAKGFGVFLGEKSLRLLVPFVLAIFVFLIPRLYFGQQFEDWCRPN
Ga0208544_1040549623300025887AqueousMFFYISGIGSTFFNTETKNYGIFVGEKILRLLIPFVIAIFVFLIPRLYFGQQYEDFTRNDGEI
Ga0208275_103614023300026182MarineMFFYISGMGATFFNTEGKGFGIFVGNKCLRLLIPFVVAIFVFLIPRLYFGQSYEDFTRPDGKTEDDYW
Ga0247581_108168513300026420SeawaterMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEW
Ga0247594_101106723300026448SeawaterMFFYISGMGSTFFNTEGKGFGNFVGNKVLRLMVPFVVAIFIFLIPRLYFGQTYEEFCRPDGKNIEEDYW
Ga0247594_102451413300026448SeawaterFFYISGMGATYFNTEGKGFGNFVGNKVLRLLVPFVVAIFIFLIPRLYFGQQYEDFCRPNGKDIEEDYWTF
Ga0247568_102307023300026462SeawaterMFFYISGMGATYFNTEGKGFFLFTWNKILRLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDKNHMENDYWEFNK
Ga0247588_103508813300026465SeawaterMFFYISGMGATFFNTEGKGFFLFTWNKITRLLIPFVIAIFIFLIPRLYFGQPYEEWCRYDKKPRLMITGSSIS
Ga0247571_101242833300026495SeawaterMFFYISGMGATYFNTEGKGFGNFVGNKVLRLLVPFVVAVFIFLIPRLYFGQQYEDFCRPNGKDIEEDYWTF
Ga0247592_103927223300026500SeawaterMFFYIAGMGATFYNTEGKGFGNFVGNKTLRLIVPFCIAIFVFLIPRLYFGQSYEDFTRPDGKQEDDYWQF
Ga0247590_120270623300026513SeawaterMFFYISGMGATYFNTEGKGFFLFTWNKILTLLIPFVIAIFVFLIPRLYFGQPYEDWCRPDKNHMENDYWEFNK
Ga0208673_106761813300027192EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKNV
Ga0208305_1030470613300027753EstuarineMFFYISGMGATFFNTEGKGFGIFVTDKVLRLMLPFVIAIFVFLIPRLYFGQQYEDWTRPDGKH
Ga0209279_1016529713300027771MarineMFFYISGIGSTFFDTEKNNYGMFVLGKVLRLFLPFVLGIFAFLIPRLYFGQQYEDFTRNNDVIENDYWTFMLAT
Ga0209092_1047258313300027833MarineMFFYISGIGATFFKTEDKNYGIFVGEKALRLLLPFTIGIFAFLMPRLYFGQTYEDFTRPNDEIEEIAVVKAIPDSPGIF
Ga0209092_1050649223300027833MarineMFFYISGMASTFYNTEGKGFGLFLGDKTLRLIVPFVLALFIFLMPRLYFGQAYEDWCRPNDE
Ga0209712_1058575923300027849MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVIAIFVFLIPRLYFGQPYEEWCRYDKK
Ga0209668_1007703123300027899Freshwater Lake SedimentMFFYISGMGSTFFNTEGKGFGIFFGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0209668_1118023213300027899Freshwater Lake SedimentMFFYVSGMASTYFNTEGKGFGIFVGDKTLRLLVPFVLAIFIFLIPRLYFGQAYEDFTRPD
Ga0256412_103941023300028137SeawaterMFFYISGMAMTFYNTEGKGFGVFLGEKSLRLLVPLVLAIFIFLIPRLYFGQQYEDWCRPDENNGESENDYWTF
Ga0256412_134163813300028137SeawaterMFFYISGMGATFFNTEGKGFGNFVGNKVLRLLVPFVIAVFIFLIPRLYFGQQYEDFCRPDGKNIEDDYWTF
Ga0272440_108193323300028595Marine SedimentMFFYISGMGATFYNTEKKGFGQFFGNKTLRLMVPFVLAIFVFLIPRLYFGQQYEDFTRPDGKIEEDYWAF
Ga0073964_1000115613300030788MarineMFFYISGMASTFFNTEGKGFGLFFLDKVLRLLLPFVIAIFIFLMPRLYMGQEYEDWTRPNGQTEKDYWQFNIKTLPSIFSKLSW
Ga0073964_1001380233300030788MarineMFFYISGMAATFFSTEGRGFGLFLGDKALRLLVPFVIAVFIFLIPRLYFGQEYEDFTRPDGKTETDYWEF
Ga0307489_1137047023300031569Sackhole BrineMFFYISGMGATFFNTEGKGFGNFVGNKTLRLVVPFIIAVFVFLIPRLYFGQSYEDFTRPGGKVEEDYWAFQMKTL
Ga0308134_108382323300031579MarineMFFYISGMGSTFFNTEGKGFFLFTWNKITRLLIPFVVAIFIFLIPRLYFGQPYEEWCRYDKKT
Ga0307386_1070749013300031710MarineMFFYISGMGATFFNTEGKGFGIFVGDKILRLMVPFIAAIFIFLIPRLYFGQQYEDFTRPDGKIEEDYWQFMIK
Ga0307391_1011822923300031729MarineMFFYISGMGATFFNTESKGFGIFVGDKILRLLVPFVLAIFIFLIPRLYFGQQYEDFTRPDGKIEEDYW
Ga0307391_1047444723300031729MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRPLIPFVIAIFVFLIPRLYFGQPYEDWCRPDKVNIENDYW
Ga0315899_1037439323300031784FreshwaterMFFYISGMASTYFNSEGKGFGLFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0315899_1117773213300031784FreshwaterMFFYISGMASTFFNSEGKGFGMFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0314676_1067598113300032519SeawaterMFFYISGMGATFFNTEGKGFGIFVGDKSLRLLVPFIVGIFIFLIPRLYFGQQYEDFTRPNGKVEEDYWAFMIQTLPTIFSKL
Ga0314677_1073393713300032522SeawaterMFFYISGMGATFYNTEGKGFGSFVGNKILRLMVPFVVAIFIFLIPRLYFGQPYEEFCRPDGKNIEDDY
Ga0307390_1103655313300033572MarineMFFYISGMGATFFNTEGKGFFLFTWNKILRLFIPFVIAIFVFLIPRLYFGQPYEEWCRPDKVNMENDYWEFNKKIIP
Ga0335005_0435455_76_2733300034022FreshwaterMGIPMFFYVSGMASTYFNTEGKGFGIFVGDKTLRLLVPFVLAIFIFLIPRLYFGQAYEDFTRPDG
Ga0334983_0190339_11_2023300034060FreshwaterMASTFFNSEGKGFGMFVGDKVLRLLVPFVLAIFIFLIPRLYFGQEYEDFTRPDGVTEPDYLKF
Ga0334983_0672930_347_5533300034060FreshwaterMFFYISGIGSTFFRTEDKNFAIFVGEKVLRLLVPFIIGIFVFLIPRLYFGQTYEDWTRPNADGTMDSNY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.