NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090906

Metagenome Family F090906

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090906
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence HLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Number of Associated Samples 100
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 98.15 %
% of genes from short scaffolds (< 2000 bps) 92.59 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.222 % of family members)
Environment Ontology (ENVO) Unclassified
(19.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.593 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF04366Ysc84 51.85
PF01554MatE 4.63
PF02424ApbE 1.85
PF00857Isochorismatase 0.93
PF12094DUF3570 0.93
PF10009DUF2252 0.93
PF13428TPR_14 0.93
PF14559TPR_19 0.93
PF04267SoxD 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 51.85
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 1.85
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.93
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG4311Sarcosine oxidase delta subunitAmino acid transport and metabolism [E] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886015|FOassembled-_contig08744All Organisms → cellular organisms → Bacteria → Proteobacteria1337Open in IMG/M
3300002070|JGI24750J21931_1029131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria803Open in IMG/M
3300005181|Ga0066678_10552595All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300005181|Ga0066678_10951073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria559Open in IMG/M
3300005332|Ga0066388_100170885All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2773Open in IMG/M
3300005437|Ga0070710_10753734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria692Open in IMG/M
3300005444|Ga0070694_100784314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria780Open in IMG/M
3300005454|Ga0066687_10102072All Organisms → cellular organisms → Bacteria → Proteobacteria1449Open in IMG/M
3300005538|Ga0070731_10191242All Organisms → cellular organisms → Bacteria → Proteobacteria1359Open in IMG/M
3300005539|Ga0068853_101820859All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria590Open in IMG/M
3300005566|Ga0066693_10008783All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2783Open in IMG/M
3300005569|Ga0066705_10231832All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300005576|Ga0066708_10065823All Organisms → cellular organisms → Bacteria → Proteobacteria2070Open in IMG/M
3300005842|Ga0068858_101089817All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300005993|Ga0080027_10108888All Organisms → cellular organisms → Bacteria → Proteobacteria1043Open in IMG/M
3300006163|Ga0070715_10797438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria573Open in IMG/M
3300006164|Ga0075441_10092605All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300006174|Ga0075014_100587151All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria635Open in IMG/M
3300006358|Ga0068871_100352795All Organisms → cellular organisms → Bacteria → Proteobacteria1301Open in IMG/M
3300006796|Ga0066665_10059698All Organisms → cellular organisms → Bacteria → Proteobacteria2663Open in IMG/M
3300006800|Ga0066660_11280252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria574Open in IMG/M
3300007258|Ga0099793_10286121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium799Open in IMG/M
3300009093|Ga0105240_11266821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria779Open in IMG/M
3300009137|Ga0066709_100891150All Organisms → cellular organisms → Bacteria → Proteobacteria1296Open in IMG/M
3300009502|Ga0114951_10135356All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300010046|Ga0126384_11829041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria577Open in IMG/M
3300010321|Ga0134067_10165558All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium796Open in IMG/M
3300010360|Ga0126372_11019567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria840Open in IMG/M
3300010375|Ga0105239_12669801All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria583Open in IMG/M
3300010397|Ga0134124_12904643All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria523Open in IMG/M
3300012206|Ga0137380_10592448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria970Open in IMG/M
3300012359|Ga0137385_10242322All Organisms → cellular organisms → Bacteria → Proteobacteria1563Open in IMG/M
3300012359|Ga0137385_11099370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria654Open in IMG/M
3300012582|Ga0137358_10373619All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium965Open in IMG/M
3300012683|Ga0137398_10448480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium882Open in IMG/M
3300012923|Ga0137359_11669199All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium525Open in IMG/M
3300012925|Ga0137419_10360156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1127Open in IMG/M
3300012927|Ga0137416_10468760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1080Open in IMG/M
3300012929|Ga0137404_10901411All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium806Open in IMG/M
3300012944|Ga0137410_10666855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria864Open in IMG/M
3300012975|Ga0134110_10240017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium769Open in IMG/M
3300014654|Ga0181525_10778156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria539Open in IMG/M
3300015371|Ga0132258_12722631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1233Open in IMG/M
3300016319|Ga0182033_10457134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1090Open in IMG/M
3300017970|Ga0187783_10523698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria859Open in IMG/M
3300017970|Ga0187783_10739150All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium710Open in IMG/M
3300017970|Ga0187783_11318813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium520Open in IMG/M
3300017974|Ga0187777_11306652All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium533Open in IMG/M
3300017975|Ga0187782_11140451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria609Open in IMG/M
3300018058|Ga0187766_11406683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria512Open in IMG/M
3300018433|Ga0066667_11220367All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria655Open in IMG/M
3300020581|Ga0210399_10786556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium778Open in IMG/M
3300021432|Ga0210384_11201512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium662Open in IMG/M
3300021475|Ga0210392_10539853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria862Open in IMG/M
3300021559|Ga0210409_11220967All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria627Open in IMG/M
3300021560|Ga0126371_11807104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria732Open in IMG/M
3300021560|Ga0126371_11839295All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria726Open in IMG/M
3300021560|Ga0126371_13866445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria505Open in IMG/M
3300023265|Ga0247780_1040934All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1147Open in IMG/M
3300025162|Ga0209083_1081204All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300025906|Ga0207699_10172667All Organisms → cellular organisms → Bacteria → Proteobacteria1447Open in IMG/M
3300025914|Ga0207671_10230878All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300025914|Ga0207671_11520046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria516Open in IMG/M
3300025916|Ga0207663_10340853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1132Open in IMG/M
3300025928|Ga0207700_10280103All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1434Open in IMG/M
3300025929|Ga0207664_10177435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1827Open in IMG/M
3300025938|Ga0207704_10058098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2380Open in IMG/M
3300025939|Ga0207665_11017227All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria659Open in IMG/M
3300026088|Ga0207641_10835394All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria912Open in IMG/M
3300026312|Ga0209153_1006220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3729Open in IMG/M
3300026481|Ga0257155_1044100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium688Open in IMG/M
3300026527|Ga0209059_1000189All Organisms → cellular organisms → Bacteria → Proteobacteria26643Open in IMG/M
3300026551|Ga0209648_10456271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium788Open in IMG/M
3300027521|Ga0209524_1035383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1047Open in IMG/M
3300027587|Ga0209220_1018575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1853Open in IMG/M
3300027651|Ga0209217_1114690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria762Open in IMG/M
3300027680|Ga0207826_1067057All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria989Open in IMG/M
3300027681|Ga0208991_1077308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1002Open in IMG/M
3300027853|Ga0209274_10686303All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium528Open in IMG/M
3300028906|Ga0308309_10327301All Organisms → cellular organisms → Bacteria → Proteobacteria1302Open in IMG/M
3300031231|Ga0170824_108043494All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria603Open in IMG/M
3300031544|Ga0318534_10433668All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria753Open in IMG/M
3300031681|Ga0318572_10473435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria746Open in IMG/M
3300031715|Ga0307476_10516877All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria885Open in IMG/M
3300031723|Ga0318493_10211072All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1027Open in IMG/M
3300031744|Ga0306918_10317776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1203Open in IMG/M
3300031765|Ga0318554_10034426All Organisms → cellular organisms → Bacteria → Proteobacteria2732Open in IMG/M
3300031768|Ga0318509_10582799All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300031771|Ga0318546_10349167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1029Open in IMG/M
3300031779|Ga0318566_10242537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria894Open in IMG/M
3300031781|Ga0318547_10605524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria679Open in IMG/M
3300031792|Ga0318529_10316675All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria726Open in IMG/M
3300031819|Ga0318568_10219638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1174Open in IMG/M
3300031820|Ga0307473_10885430All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria643Open in IMG/M
3300031859|Ga0318527_10370582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria610Open in IMG/M
3300031896|Ga0318551_10663400All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium603Open in IMG/M
3300031897|Ga0318520_10635228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria665Open in IMG/M
3300031942|Ga0310916_11326600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria591Open in IMG/M
3300031962|Ga0307479_11916698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium543Open in IMG/M
3300031981|Ga0318531_10284130All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium747Open in IMG/M
3300032010|Ga0318569_10537461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria544Open in IMG/M
3300032039|Ga0318559_10215569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria884Open in IMG/M
3300032054|Ga0318570_10423859All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria607Open in IMG/M
3300032064|Ga0318510_10034919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1707Open in IMG/M
3300032205|Ga0307472_100266470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1354Open in IMG/M
3300032205|Ga0307472_101747494All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria616Open in IMG/M
3300032829|Ga0335070_11492124All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria616Open in IMG/M
3300033158|Ga0335077_10876910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria906Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.22%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886015Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembledEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FOassembled-_0744.000008202162886015Grass SoilDYSDFRNALYAGTDGFTAGNEPLYQLDANILQVFVSIWF
JGI24750J21931_102913123300002070Corn, Switchgrass And Miscanthus RhizosphereNKSSLSIRLDHLLIDYKDYRNALLTGTTPEFTAGNEPLYKLNANIFQIFASIWF*
Ga0066678_1055259513300005181SoilINVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0066678_1095107313300005181SoilLRVDHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF*
Ga0066388_10017088513300005332Tropical Forest SoilDHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF*
Ga0070710_1075373423300005437Corn, Switchgrass And Miscanthus RhizosphereVRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF*
Ga0070694_10078431413300005444Corn, Switchgrass And Miscanthus RhizosphereRADHLMVNYSDFRNALLAGEFGAGDEPLYKLNANIFQLFVSIWF*
Ga0066687_1010207233300005454SoilVRVDHLLVDYSDFRNALLAGTYGAGNEPLYELNANIFQVFVSIWF*
Ga0070731_1019124233300005538Surface SoilDHLLVDYSDFRDALLAAQYGAGKEPLYKLNANILQVFVSVWY*
Ga0068853_10182085913300005539Corn RhizosphereHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY*
Ga0066693_1000878343300005566SoilYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0066705_1023183213300005569SoilLLVDYSDFRNALLAGTYGAGNEPLYKLNANVFQVFVSIWF*
Ga0066708_1006582333300005576SoilLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0068858_10108981723300005842Switchgrass RhizosphereIRYDHLMIDYGDYRNALYSKFGGGQPGAEPLYSLDANIFQVFVSIWF*
Ga0080027_1010888823300005993Prmafrost SoilFNVHVARLMIDYSDFRNALLAGEYGAGNEPLYKLNATVFTVFISVWY*
Ga0070715_1079743813300006163Corn, Switchgrass And Miscanthus RhizosphereDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF*
Ga0075441_1009260523300006164MarineDYRNALLIGANPDWTAGSEPLYKLNANILQAFLSVWF*
Ga0075014_10058715123300006174WatershedsANVRFNHMLIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF*
Ga0068871_10035279513300006358Miscanthus RhizosphereHYAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY*
Ga0066665_1005969813300006796SoilHLMIDYSDYRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0066660_1128025213300006800SoilNLRVDHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF*
Ga0099793_1028612113300007258Vadose Zone SoilSKSSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0105240_1126682113300009093Corn RhizosphereYSDFRNALLDGSGYTVGNEPLYKLNANVIQAFVSVWF*
Ga0066709_10089115013300009137Grasslands SoilDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0114951_1013535613300009502FreshwaterDDFRDATQAQTYGAGNEPLYKYNANVVQAFLTVWF*
Ga0126384_1182904113300010046Tropical Forest SoilRMRVDYKDFRDALLAARYGAGNEPLYKLDANVLEAFLSIWY*
Ga0134067_1016555813300010321Grasslands SoilLLVDYSDFRNALLAGTYGAGNEPLYELNANIFQVFVSIWF*
Ga0126372_1101956713300010360Tropical Forest SoilHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF*
Ga0105239_1266980123300010375Corn RhizosphereLLIDYKDYRNALLTGTSGYTAGNEPLYKLNANVVQLYGTLWF*
Ga0134124_1290464313300010397Terrestrial SoilYRNALLIGANPAWSAGNEPLYKLNANILQAFWSVWF*
Ga0137380_1059244813300012206Vadose Zone SoilSINLRVDHLMIDYGDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF*
Ga0137385_1024232213300012359Vadose Zone SoilYKDYRNALLTGTSPQFTTGNEPLYKLNANIFQVFASIWF*
Ga0137385_1109937013300012359Vadose Zone SoilLMIDYRDFRNALLAGTYGAGNEPLYKLNANIFQVFFSIWF*
Ga0137358_1037361913300012582Vadose Zone SoilSSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0137398_1044848013300012683Vadose Zone SoilNVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSLWF*
Ga0137359_1166919923300012923Vadose Zone SoilISKSSANVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0137419_1036015613300012925Vadose Zone SoilLMIDYGDFRNALLAGTYGAGNEPLYKLNANIFQLFLSIWF*
Ga0137416_1046876013300012927Vadose Zone SoilKDYRNALLTGTSPEFTAGNEPLYKLNANIFQVFASIWF*
Ga0137404_1090141113300012929Vadose Zone SoilVRVDHLLVDYRDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0137410_1066685523300012944Vadose Zone SoilNKSSLSIRLDHLLINYKDYRNALLTGTTPEFTAGNEPLYKLNANIFQVFASIWF*
Ga0134110_1024001713300012975Grasslands SoilDHLMIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF*
Ga0181525_1077815623300014654BogLAKYSDFRDALLAPEYGAGNEPLYQLNANVFTMFLSVWY*
Ga0132258_1272263113300015371Arabidopsis RhizosphereVRFDHLFIDYKDFRNALLASQYGAGNEPLYKLNANIFQVFVSIWF*
Ga0182033_1045713413300016319SoilRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLDANIFQIFVSIWF
Ga0187783_1052369823300017970Tropical PeatlandVDYSDFRNALLAGVYGAGKEPLYVLNANIFQLFVSIWY
Ga0187783_1073915023300017970Tropical PeatlandFEHLLVKYSDFRNALLASEYGAGNEPLYVLNANIAQIYISIWY
Ga0187783_1131881313300017970Tropical PeatlandPWISRSTANVALDHLLVKYSDFRNALLAGEYGAGNEPLYVLNANIFQVFVSTWF
Ga0187777_1130665223300017974Tropical PeatlandDHLLIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF
Ga0187782_1114045113300017975Tropical PeatlandRMMISYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSLWY
Ga0187766_1140668323300018058Tropical PeatlandDYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSIWY
Ga0066667_1122036723300018433Grasslands SoilIDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0210399_1078655613300020581SoilLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0210384_1120151213300021432SoilVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0210392_1053985323300021475SoilLLVDYKDFRNALLIGANPDWSAGNEPLYKLNANILQAYLSVWF
Ga0210409_1122096713300021559SoilYSDLRNALLAPEYGAGNEPLYKLNANVYTILLSIWY
Ga0126371_1180710413300021560Tropical Forest SoilFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Ga0126371_1183929513300021560Tropical Forest SoilKYSDYRNALLASEYGAGNEPLYVLNANIFQVFVSIWF
Ga0126371_1386644523300021560Tropical Forest SoilSKSTFNVRYDRMMIAYKDFRDALLAAQYGAGGEPLYKLDANVLEAYLSLWY
Ga0247780_104093423300023265Plant LitterYKDYRNALLIGANPDWSAGNEPLYKLNANILQLFWSIWF
Ga0209083_108120433300025162FreshwaterDDFRDATQAQTYGAGNEPLYKYNANVVQAFLTVWF
Ga0207699_1017266713300025906Corn, Switchgrass And Miscanthus RhizosphereDFRNALLAGNGTYTAGNEPLYKLNANVLQLFWSLWF
Ga0207671_1023087833300025914Corn RhizosphereKDYRNALLIGANPDWTAGNEPLYKLNANILQAFISVWF
Ga0207671_1152004613300025914Corn RhizosphereNRSTFTLRYDHLLIDYKDFRNALLIGANPDWSAGNEPLYKLNVNILQAYLSVWF
Ga0207663_1034085313300025916Corn, Switchgrass And Miscanthus RhizosphereHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY
Ga0207700_1028010313300025928Corn, Switchgrass And Miscanthus RhizosphereDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF
Ga0207664_1017743513300025929Agricultural SoilSDFRNALLAGEFGAGDEPLYKLNANIFQLFVSIWF
Ga0207704_1005809833300025938Miscanthus RhizosphereYAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY
Ga0207665_1101722723300025939Corn, Switchgrass And Miscanthus RhizosphereEHFLADYNDFRNALLAPEYGAGNEPLYKLNANVFTVQVSAWY
Ga0207641_1083539413300026088Switchgrass RhizosphereVHYAHLMIDYADFRNALLADQYGAGNEPLYKLNANVLTAFFSIWY
Ga0209153_100622013300026312SoilKNSINVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0257155_104410013300026481SoilIDYGDFRNALLAGTYGAGNEPLYKLNANVFQVFLSIWF
Ga0209059_1000189243300026527SoilLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0209648_1045627123300026551Grasslands SoilVRVDHLLVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0209524_103538313300027521Forest SoilDHLLVDYSDFRNALLAGSYGPGNEPLYKLNANIFQVFVSIWF
Ga0209220_101857533300027587Forest SoilMVDYSDFRNALLAGTYGAGNEPLYKLNANIFQVFVSIWF
Ga0209217_111469023300027651Forest SoilRLDHLLIDYKDFRNALLTGTAPGFTAGNEPLYKLNATIFQAFVSVWF
Ga0207826_106705723300027680Tropical Forest SoilYDRMMIDYKDFRNALLAAQYGAGNEPLYKLDANILEAWFSIYF
Ga0208991_107730813300027681Forest SoilKDFRNALLTGTAPGFTAGNEPLYKLNATIFQGFVSVWF
Ga0209274_1068630313300027853SoilRADHLLIDYSDYRDALLAEEDGPGREPLYKLNANIFQVFVSIWY
Ga0308309_1032730133300028906SoilNALYSLDGVAGYTAGNEPLYKLDANIFQLFVSIWF
Ga0170824_10804349413300031231Forest SoilNDFRNALLAAQYGAGNEPLYKLNANVFTVFLSIWY
Ga0318534_1043366823300031544SoilRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318572_1047343513300031681SoilVRYNRLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Ga0307476_1051687713300031715Hardwood Forest SoilYRNALLIGTNPAYTAGNEPLYKLNANILQLFASLYF
Ga0318493_1021107213300031723SoilNVRFDHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0306918_1031777613300031744SoilYKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF
Ga0318554_1003442613300031765SoilVRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF
Ga0318509_1058279913300031768SoilANVRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318546_1034916723300031771SoilNVRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF
Ga0318566_1024253723300031779SoilNVRFDHLLIDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF
Ga0318547_1060552423300031781SoilLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318529_1031667523300031792SoilYNHLMIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318568_1021963823300031819SoilIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0307473_1088543013300031820Hardwood Forest SoilMMVDYKDFRDALLAARYGAGNEPLYKLDANVLEAFLSIWY
Ga0318527_1037058223300031859SoilRYDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318551_1066340013300031896SoilDYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF
Ga0318520_1063522823300031897SoilKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0310916_1132660023300031942SoilDHLFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0307479_1191669813300031962Hardwood Forest SoilANVRFDHLFIDYKDFRNALLAGEYGAGNEPLYKLNANIFQIFVSIWF
Ga0318531_1028413023300031981SoilYKDFRNALLAGEYGAGNEPLYKLNANIFQLFVSIWF
Ga0318569_1053746113300032010SoilLRFDHMYIDYKDFRNALLASEYGAGNEPFYKLNANIFQAFVSIWF
Ga0318559_1021556913300032039SoilLLIDYKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF
Ga0318570_1042385923300032054SoilFIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0318510_1003491933300032064SoilHLFIDYKDFRNALLANEYGAGNEPLYKLNANIFQIFVSIWF
Ga0307472_10026647013300032205Hardwood Forest SoilDYSDFRNALLAGTYGAGNEPLYKLNANIFQMFVSIWF
Ga0307472_10174749413300032205Hardwood Forest SoilNIQLEHFLADYNDFRNALLAPEYGAGNEPLYKLNANVFTVQVSAWY
Ga0335070_1149212423300032829SoilLYIDYKDFRNALLASEYGAGNEPLYKLNANIFQVFVSIWF
Ga0335077_1087691013300033158SoilMMIDYKDFRDALLAAQYGAGNEPLYKLDANVLEAFLSIWY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.