NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090926

Metagenome Family F090926

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090926
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 44 residues
Representative Sequence LTRIINGVQRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF
Number of Associated Samples 92
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.59 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.593 % of family members)
Environment Ontology (ENVO) Unclassified
(24.074 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.852 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.63%    β-sheet: 11.27%    Coil/Unstructured: 83.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF10082BBP2_2 15.74
PF09721Exosortase_EpsH 4.63
PF02638GHL10 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1649Uncharacterized lipoprotein YddW, UPF0748 familyFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01B74XPAll Organisms → cellular organisms → Bacteria525Open in IMG/M
2189573000|GPBTN7E01EN7JBAll Organisms → cellular organisms → Bacteria538Open in IMG/M
3300000956|JGI10216J12902_121982799All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300002075|JGI24738J21930_10085328All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300004157|Ga0062590_100517945All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300004157|Ga0062590_101900869All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300004463|Ga0063356_102208449All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300004479|Ga0062595_100328180All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300005093|Ga0062594_101207424All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300005175|Ga0066673_10482906All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005178|Ga0066688_10050738All Organisms → cellular organisms → Bacteria2398Open in IMG/M
3300005187|Ga0066675_10519076All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005289|Ga0065704_10655146All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005332|Ga0066388_101937549All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300005446|Ga0066686_10248394All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300005446|Ga0066686_10308223All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300005468|Ga0070707_101048093All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300005545|Ga0070695_101239334All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005553|Ga0066695_10605192All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005554|Ga0066661_10034268All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2825Open in IMG/M
3300005576|Ga0066708_10266084All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005615|Ga0070702_100780515All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005764|Ga0066903_100505227All Organisms → cellular organisms → Bacteria2050Open in IMG/M
3300005764|Ga0066903_100603944All Organisms → cellular organisms → Bacteria1902Open in IMG/M
3300006163|Ga0070715_10355288All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006175|Ga0070712_100694493All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300006800|Ga0066660_10571332All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300007255|Ga0099791_10316327All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300007265|Ga0099794_10175634All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300009098|Ga0105245_10398032All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300009098|Ga0105245_12520390All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010038|Ga0126315_11245520All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300010043|Ga0126380_10777530All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300010047|Ga0126382_12237924All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010321|Ga0134067_10490624All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010337|Ga0134062_10191611All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300010337|Ga0134062_10275132All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300010358|Ga0126370_10754618All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300010362|Ga0126377_12528882All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300010366|Ga0126379_10242705All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300010366|Ga0126379_11541236All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300010371|Ga0134125_10673444All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300010376|Ga0126381_103352366All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300010376|Ga0126381_103695481All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300010398|Ga0126383_11588522All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012202|Ga0137363_10631756All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300012202|Ga0137363_11311573All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300012206|Ga0137380_10164272All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300012208|Ga0137376_11492519All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012209|Ga0137379_10231706All Organisms → cellular organisms → Bacteria1761Open in IMG/M
3300012285|Ga0137370_10160415All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300012285|Ga0137370_10652884All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300012356|Ga0137371_10093434All Organisms → cellular organisms → Bacteria2339Open in IMG/M
3300012356|Ga0137371_10601405All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300012356|Ga0137371_11337574All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012357|Ga0137384_10365417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1195Open in IMG/M
3300012469|Ga0150984_120982757All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300012532|Ga0137373_10349736All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300012923|Ga0137359_10160067All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300012927|Ga0137416_11192939All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012948|Ga0126375_11645277All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012961|Ga0164302_10045317All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300012961|Ga0164302_10378193All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300012971|Ga0126369_12708561All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300013297|Ga0157378_12464156All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300015264|Ga0137403_10334817All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300015356|Ga0134073_10408731All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300015359|Ga0134085_10162295All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300015373|Ga0132257_103205113All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300015374|Ga0132255_101248960All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300015374|Ga0132255_101349112All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300016371|Ga0182034_10310969All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300018431|Ga0066655_10785209All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018482|Ga0066669_11018482All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300018482|Ga0066669_11592852All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300019789|Ga0137408_1066394All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300019890|Ga0193728_1369844All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300020015|Ga0193734_1067151All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300021178|Ga0210408_11318767All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300022534|Ga0224452_1020975All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300022694|Ga0222623_10209212All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300022756|Ga0222622_10904413All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025904|Ga0207647_10244180All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300025915|Ga0207693_10556048All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300025922|Ga0207646_11352337All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025930|Ga0207701_11224892All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300025939|Ga0207665_10936684All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300026312|Ga0209153_1226452All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026324|Ga0209470_1344016All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300026326|Ga0209801_1300636All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300026328|Ga0209802_1255611All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300026536|Ga0209058_1207807All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300026547|Ga0209156_10113551All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300026548|Ga0209161_10443690All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027655|Ga0209388_1049532All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300027748|Ga0209689_1168819All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300027874|Ga0209465_10617243All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium536Open in IMG/M
3300028807|Ga0307305_10493456All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300028878|Ga0307278_10042855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2058Open in IMG/M
3300028881|Ga0307277_10240902All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031231|Ga0170824_111850396All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031231|Ga0170824_123410604All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031474|Ga0170818_100786457All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031474|Ga0170818_101295606All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031720|Ga0307469_12385052All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031941|Ga0310912_11260765All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300032059|Ga0318533_11369736All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300032205|Ga0307472_100696614All Organisms → cellular organisms → Bacteria913Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_35154702040502001SoilRIINGVQRTETINLRQSIHGNPIYPEYVQDGDVIYISRSLFN
N55_021866702189573000Grass SoilIINGEQVTETFNLKPTIHGKVTKPKYVQDGDVIYITRSFF
JGI10216J12902_12198279913300000956SoilGGVSDYGSASNVHLTRIIGGVQRTETINLRQSIHGNPIYPEYVQDGDVIYISRSLF*
JGI24738J21930_1008532823300002075Corn RhizosphereRTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF*
Ga0062590_10051794523300004157SoilRIINGEQRTETINLRPIIHGEPTKPEYVQDGDVIYISRSWF*
Ga0062590_10190086913300004157SoilRIIAGEERTETINLRPTVKGKPTLPKYVQDGDVIYISRNWF*
Ga0063356_10220844923300004463Arabidopsis Thaliana RhizosphereFDRPKTVYQAIMDAGGVSDYGSWRNIHLTRIINGVQRTETINLRPVIHGEPIEPEYVQEGDVIYISRSWF*
Ga0062595_10032818013300004479SoilASNVHLTRIINGQQVTETVNLRPTIHGEPTRPTYVQDGDVIYVGRSWF*
Ga0062594_10120742413300005093SoilIINGLQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF*
Ga0066673_1048290613300005175SoilTRIINGVQRTETVNLRPAIHGQPVRPEYVQDGDVIYIARSLF*
Ga0066688_1005073833300005178SoilSDYGSPSNIHLTRVINGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF*
Ga0066675_1051907623300005187SoilYGSASSIHLTRIIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF*
Ga0065704_1065514613300005289Switchgrass RhizosphereLTRIINGVQRTETINLRPVIHGEPIEPEYVQDGDVIYISRSWF*
Ga0066388_10193754923300005332Tropical Forest SoilSPSNIHLTRIIDGEQRTEFINLRPAIHGQPVRPEYVQDGDVIYIARSLF*
Ga0066686_1024839423300005446SoilRIINGVQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF*
Ga0066686_1030822323300005446SoilSNIHLTRIINGEQRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF*
Ga0070707_10104809313300005468Corn, Switchgrass And Miscanthus RhizosphereLTRIINGAQLTESINLRATIRGKPTKPKYVEDGDVIYIARSWF*
Ga0070695_10123933423300005545Corn, Switchgrass And Miscanthus RhizosphereNIHLTRVINGEQLTETFSLKPSIRGEPVKPKYVQDGDVIYIGRSLF*
Ga0066695_1060519223300005553SoilQRSETVNLRPTIRGEPTKPTYVEDGDVIYISRSLF*
Ga0066661_1003426833300005554SoilIHLTRIINGVQRTERINLRPSIRGKPIQPKYVQDGDVIYIARSLF*
Ga0066708_1026608423300005576SoilLTRIINGVQRTETINLRPNIRGKPTNPEYVQDGDVIYIARSLF*
Ga0070702_10078051523300005615Corn, Switchgrass And Miscanthus RhizosphereIRIINGEQRVEIFSLRPTIRGEPTQPKYVKDGDVIYVSRSLL*
Ga0066903_10050522713300005764Tropical Forest SoilNGVQQTERINLRPSIHGEPTQPKYVQDGDVIYIARSLF*
Ga0066903_10060394413300005764Tropical Forest SoilSNIHLTRIINGVQRTESLNLKPSIRGQPVEPEYVQDGDVIYIGRSLF*
Ga0070715_1035528813300006163Corn, Switchgrass And Miscanthus RhizosphereTRIINGLQRTETINLRPAIRGEPINPKYIQDGDVIYISRSLF*
Ga0070712_10069449313300006175Corn, Switchgrass And Miscanthus RhizosphereQLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF*
Ga0066660_1057133213300006800SoilIIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF*
Ga0099791_1031632713300007255Vadose Zone SoilSSVHLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF*
Ga0099794_1017563413300007265Vadose Zone SoilINGEQRTEVINLRPTVHGKPTIPKYVQDGDVIYISRNWF*
Ga0105245_1039803213300009098Miscanthus RhizosphereIINGEQRTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF*
Ga0105245_1252039013300009098Miscanthus RhizosphereRIINGVQLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF*
Ga0126315_1124552013300010038Serpentine SoilASNIHLTRIIDGKQLSETINLRPAIHGQPVKPEYVQDGDVIYIGRSLF*
Ga0126380_1077753013300010043Tropical Forest SoilVQRTERINLRPSIHGEPLYPKYVQDGDVIYISRSLF*
Ga0126382_1223792413300010047Tropical Forest SoilRIIDGVQRTETINLRPSIRGKTIQPEYVKDGDVIYISRSLF*
Ga0134067_1049062413300010321Grasslands SoilVHLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARNWF*
Ga0134062_1019161123300010337Grasslands SoilLTRIINGVQRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF*
Ga0134062_1027513213300010337Grasslands SoilSNIHLTRIINGEQRTEMINLRPSIHGEPTKPKYVQDGDVVYISRSLF*
Ga0126370_1075461823300010358Tropical Forest SoilASNIRLTRIINGVQRAETINLRKSIHGTPVYPEYVKDGDVIYLARSLF*
Ga0126377_1252888223300010362Tropical Forest SoilINGEQRTETINLRPSIHGEPTQPKYVQDGDVIYIARSLF*
Ga0126379_1024270533300010366Tropical Forest SoilVSDYGSASNIHLTRIVDGVQRTERINLRPSIHGEALYPKYVQDGDVIYISRSLF*
Ga0126379_1154123613300010366Tropical Forest SoilIINGVQQTERINLRPSIRGQLTQPKYVQDGDVIYISRSLF*
Ga0134125_1067344423300010371Terrestrial SoilVSDYGSASNIHLTRIINGVQLTETINLRPSIHGQPIYPKYVQDGDVIYILRSLFLPVVPAGRDLQT*
Ga0126381_10335236613300010376Tropical Forest SoilRTETFNLKPTLHGHTTKPKYVQDGDVIYISRSFF*
Ga0126381_10369548113300010376Tropical Forest SoilSASSVHLTRIIDGVQRTETINLRTAILGQPLRPEYVQEGDVIYIARSLF*
Ga0126383_1158852213300010398Tropical Forest SoilSDYGSASNIHLTRIIDGVQRTERINLRPSIHGEPLYPKYVQDGDVIYISRSLF*
Ga0137363_1063175613300012202Vadose Zone SoilQRSETVNLRPTIRGESTKPTYVEDGDVIYISRSLF*
Ga0137363_1131157313300012202Vadose Zone SoilLSNVHLTRMINGEQRTEVINLRPTVHGKPTLPIYVQDGDVIYISRNWF*
Ga0137380_1016427213300012206Vadose Zone SoilGEQRTETINLRPTIHGKPTKPKYVQDGDVIYISRSWF*
Ga0137376_1149251913300012208Vadose Zone SoilRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF*
Ga0137379_1023170633300012209Vadose Zone SoilTRIINGVQVTETINLKPSIRGQPTQPKYVQDGDVIYISRSLF*
Ga0137370_1016041513300012285Vadose Zone SoilNVHLTRIINGEQRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF*
Ga0137370_1065288413300012285Vadose Zone SoilSASNIHLTRIIDGIEQTETINLRPAIHGQLTKPKYVRDGDVIYISRSWF*
Ga0137371_1009343413300012356Vadose Zone SoilIHLTRIINGEQRTETINLRPTVHGEPTLPTYVQDGDVIYISRSWF*
Ga0137371_1060140513300012356Vadose Zone SoilQRTETLSLKPTIRGNPTKPKYVQDGDVIYISRSLF*
Ga0137371_1133757413300012356Vadose Zone SoilYGSPSNVHLTRIINGEQRTETINLRSAIRGTPIKPKYVQDGDVIYIARSWF*
Ga0137384_1036541713300012357Vadose Zone SoilIDGVQRTETINLRPNIRGKPTNPKYVQDGDVIYISRSWF*
Ga0150984_12098275713300012469Avena Fatua RhizosphereSNIHLTRIINGVQRTESLNLRPSIRGQPVQPEYVQDGDVIYIGRSLF*
Ga0137373_1034973613300012532Vadose Zone SoilVQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF*
Ga0137359_1016006733300012923Vadose Zone SoilIHLTRIIKGEQRTETLNLRPTIHGNPTKPKYVQDGDVIYISRSWF*
Ga0137416_1119293923300012927Vadose Zone SoilHLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF*
Ga0126375_1164527713300012948Tropical Forest SoilTRIIDGVQRTETINLRPSIRGKTIQPEYVKDGDVIYISRSLF*
Ga0164302_1004531713300012961SoilSNIHLTRIINGLQRTETINLRPAIRGELINPKYIQDGDVIYISRSLF*
Ga0164302_1037819313300012961SoilNGVQRTESLNLKPSIRGQPVHPAYVQDGDVIYIGRSLL*
Ga0126369_1270856123300012971Tropical Forest SoilDYGSASNIHLTRIIDGVQRTERINLRPSIHGNPVYPKYVQDGDVIYISRSLF*
Ga0157378_1246415623300013297Miscanthus RhizosphereINGLQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF*
Ga0137403_1033481713300015264Vadose Zone SoilLSNVHLTRIINGEQRTEVINLRPTVHGKPTIPKYVQDGDVIYISRNWF*
Ga0134073_1040873123300015356Grasslands SoilEQRTETINLRPSIRGKPIQPKYVQDGDVIYISRSLF*
Ga0134085_1016229523300015359Grasslands SoilNGEQRTETINLRPTIRGQPTKPKYVQDGDVIYISRSLF*
Ga0132257_10320511323300015373Arabidopsis RhizosphereYQAIMEAGGVSDYGSASNVHLTRIINGVQRTETINLRQSIRCTPPIYPEYVQDGDVIYSSRSLF*
Ga0132255_10124896023300015374Arabidopsis RhizosphereVSDYGSASNVHLTRIIDGKQLTETVNLRPAIHGQPVRPEYVQDGDVIYIARSLF*
Ga0132255_10134911213300015374Arabidopsis RhizosphereLTRIINGVQRTETINLKPTVHGKVTIPKYVQDGDVIYISRSWF*
Ga0182034_1031096923300016371SoilIINGVQRTESLNLKPSIRGQPVQPEYVQDGDVIYIGRSLF
Ga0066655_1078520923300018431Grasslands SoilIINEVPRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF
Ga0066669_1101848213300018482Grasslands SoilNGVPRTEAINLRPMIHGHPTKPKYGQDGDVIYIARSLF
Ga0066669_1159285213300018482Grasslands SoilGEQRTETINLRPTVHGKPTIPKYVQDGDVIYISRNWF
Ga0137408_106639423300019789Vadose Zone SoilSNIHLTRIINGVQRTERINLRPSIHGQPVNPKYVQDGDVIYIARSLF
Ga0193728_136984413300019890SoilGEQRTETLNLKPAIRGEPTKPKYVQDGDVIYISRSLF
Ga0193734_106715123300020015SoilINGVQRTETINLRPSIRGTPIYPEYVQDGDVIYISRSLF
Ga0210408_1131876713300021178SoilINGVQRTETINLRPNIRGKPTNPKYVQDGDVIYISRSLF
Ga0224452_102097533300022534Groundwater SedimentSASNVHLTRIINGVQRTETLNLRQSIHGNPVYPEYVQDGDVIYISRSLF
Ga0222623_1020921213300022694Groundwater SedimentIHGAQRTETINLRPTIHGYPTEPKYVQDGDVIYVSRSWF
Ga0222622_1090441323300022756Groundwater SedimentGVQRSETVNLRPTIRGESTKPTYVEDGDVIYISRSLF
Ga0207647_1024418023300025904Corn RhizosphereGEQRTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF
Ga0207693_1055604813300025915Corn, Switchgrass And Miscanthus RhizosphereQLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF
Ga0207646_1135233713300025922Corn, Switchgrass And Miscanthus RhizosphereGSPSNIHLTRIINGAQLTESINLRATIRGKPTKPKYVEDGDVIYIARSWF
Ga0207701_1122489213300025930Corn, Switchgrass And Miscanthus RhizosphereSDYGSASNIHLTRIINGEQLSETINLRPDIHGYPVRPEYVQDGDVIYIGRSLF
Ga0207665_1093668413300025939Corn, Switchgrass And Miscanthus RhizosphereASNIHLTRIINGLQRTETINLRPAIRGEPINPKYIQDGDVIYISRSLF
Ga0209153_122645213300026312SoilNGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF
Ga0209470_134401623300026324SoilSNIHLTRIINGEQRTETINLRPTIRGTPIKPKYVQDGDVIYIARSWF
Ga0209801_130063623300026326SoilIINGEQRTEMINLRASIRGEPTKPKYVQDGDVIYIARSLF
Ga0209802_125561113300026328SoilSNIHLTRIINGVQRTERINLRPSIRGKPIQPKYVQDGDVIYIARSLF
Ga0209058_120780713300026536SoilQRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF
Ga0209156_1011355123300026547SoilVIDGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF
Ga0209161_1044369013300026548SoilIIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF
Ga0209388_104953213300027655Vadose Zone SoilIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF
Ga0209689_116881913300027748SoilSNIHLTRIVNGAQLTESINLRPAIHGQPVRPEYVQDGDVIYIARSLF
Ga0209465_1061724313300027874Tropical Forest SoilYGSASNIHLTRIINGVQYTERINLRPSIHGQPVDPEYVQDGDVIYISRSLF
Ga0307305_1049345613300028807SoilQRSETVNLRPTIRGEPTKPTYVEDGDVIYISRSLF
Ga0307278_1004285533300028878SoilLTRIINGVQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF
Ga0307277_1024090223300028881SoilQRTETINLRPSIRGQPIYPEYVQDGDVIYISRSLF
Ga0170824_11185039613300031231Forest SoilQRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF
Ga0170824_12341060423300031231Forest SoilVSDFGSASNIHLTRIIDGKQLTESINLKPAIKGQPLRPEYVQDGDVIYIGRSLF
Ga0170818_10078645713300031474Forest SoilGVQFTETFNLKPTIHGHPTKPEYVQDGDVIYISRSFF
Ga0170818_10129560623300031474Forest SoilINGEQRTETINLRPTVHGKPTIPEYVQDGDVIYISRNWF
Ga0307469_1238505213300031720Hardwood Forest SoilDYGSASNVHLTRIINGVQRTETINLRQSIRGKPIYPEYVQDGDVIYISRSLF
Ga0310912_1126076513300031941SoilNIHLTRLINGVQRTESLNLKPSIRGQPLQPEYVQDGDVIYIGRSLF
Ga0318533_1136973623300032059SoilIHLTRIIYGVQRTESLNLKPSIRGKPVQPEYVQDGDVIYIGRSLF
Ga0307472_10069661423300032205Hardwood Forest SoilLTRIINGEQRTETINLRPAVHGKPTLPKYVQDGDVIYISRNWF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.