Metagenome / Metatranscriptome Family F090934

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F090934
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	44 residues
Representative Sequence	MKTLISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
Number of Associated Samples	54
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	76.85 %
% of genes near scaffold ends (potentially truncated)	17.59 %
% of genes from short scaffolds (< 2000 bps)	77.78 %
Associated GOLD sequencing projects	48
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (58.333 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (25.000 % of family members)
Environment Ontology (ENVO)	Unclassified (52.778 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.296 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF12770	CHAT	6.48
PF04055	Radical_SAM	4.63
PF06463	Mob_synth_C	4.63
PF01979	Amidohydro_1	2.78
PF06808	DctM	2.78
PF02668	TauD	2.78
PF01755	Glyco_transf_25	1.85
PF00501	AMP-binding	0.93
PF13426	PAS_9	0.93
PF16576	HlyD_D23	0.93
PF00156	Pribosyltran	0.93
PF13545	HTH_Crp_2	0.93
PF00270	DEAD	0.93
PF03232	COQ7	0.93
PF04972	BON	0.93
PF00005	ABC_tran	0.93
PF14031	D-ser_dehydrat	0.93
PF03328	HpcH_HpaI	0.93
PF13546	DDE_5	0.93
PF00753	Lactamase_B	0.93
PF05231	MASE1	0.93
PF13231	PMT_2	0.93
PF13193	AMP-binding_C	0.93
PF00941	FAD_binding_5	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG2896	GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)	Coenzyme transport and metabolism [H]	4.63
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.78
COG3306	Glycosyltransferase involved in LPS biosynthesis, GR25 family	Cell wall/membrane/envelope biogenesis [M]	1.85
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.93
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.93
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.93
COG2941	Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis)	Coenzyme transport and metabolism [H]	0.93
COG3447	Integral membrane sensor domain MASE1	Signal transduction mechanisms [T]	0.93
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.93
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.33 %
Unclassified	root	N/A	41.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.33 %
Unclassified	root	N/A	41.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.33 %
Unclassified	root	N/A	41.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37.04 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	25.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.78 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.93 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2.78 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.93 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.93 %
Filomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium	0.93 %
unclassified Rhodobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae	0.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
Rhodobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	0.93 %
Filomicrobium insigne	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Filomicrobium insigne	0.93 %
Hyphomicrobium denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	0.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000363\|ICChiseqgaiiFebDRAFT_12762783	Not Available	526	Open in IMG/M
3300000550\|F24TB_10070305	Not Available	803	Open in IMG/M
3300000858\|JGI10213J12805_10006612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1562	Open in IMG/M
3300004281\|Ga0066397_10129374	Not Available	558	Open in IMG/M
3300004479\|Ga0062595_100797656	Not Available	777	Open in IMG/M
3300005332\|Ga0066388_100006911	All Organisms → cellular organisms → Bacteria → Proteobacteria	8233	Open in IMG/M
3300005332\|Ga0066388_100460966	All Organisms → cellular organisms → Bacteria	1912	Open in IMG/M
3300005332\|Ga0066388_100661323	All Organisms → cellular organisms → Bacteria	1658	Open in IMG/M
3300005332\|Ga0066388_102203507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	994	Open in IMG/M
3300005332\|Ga0066388_102416966	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300005332\|Ga0066388_102566672	Not Available	927	Open in IMG/M
3300005332\|Ga0066388_103157521	Not Available	842	Open in IMG/M
3300005332\|Ga0066388_105948652	Not Available	616	Open in IMG/M
3300005332\|Ga0066388_108213625	Not Available	521	Open in IMG/M
3300005332\|Ga0066388_108776228	Not Available	502	Open in IMG/M
3300005341\|Ga0070691_10006658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5289	Open in IMG/M
3300005713\|Ga0066905_100000836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9609	Open in IMG/M
3300005713\|Ga0066905_100003435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6230	Open in IMG/M
3300005713\|Ga0066905_100032908	All Organisms → cellular organisms → Bacteria	2968	Open in IMG/M
3300005713\|Ga0066905_100133829	All Organisms → cellular organisms → Bacteria	1756	Open in IMG/M
3300005713\|Ga0066905_100179809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1559	Open in IMG/M
3300005713\|Ga0066905_100186121	Not Available	1537	Open in IMG/M
3300005713\|Ga0066905_100239752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1385	Open in IMG/M
3300005713\|Ga0066905_100366780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156	Open in IMG/M
3300005713\|Ga0066905_100470030	Not Available	1038	Open in IMG/M
3300005713\|Ga0066905_101118523	Not Available	700	Open in IMG/M
3300005713\|Ga0066905_102303825	Not Available	503	Open in IMG/M
3300005719\|Ga0068861_100123459	All Organisms → cellular organisms → Bacteria	2092	Open in IMG/M
3300005764\|Ga0066903_100285275	Not Available	2593	Open in IMG/M
3300005764\|Ga0066903_100301070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2537	Open in IMG/M
3300005764\|Ga0066903_101379334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1322	Open in IMG/M
3300005937\|Ga0081455_10000412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	56264	Open in IMG/M
3300005937\|Ga0081455_10000994	All Organisms → cellular organisms → Bacteria	35958	Open in IMG/M
3300005983\|Ga0081540_1000205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	61689	Open in IMG/M
3300005983\|Ga0081540_1000515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37910	Open in IMG/M
3300006163\|Ga0070715_10184996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1047	Open in IMG/M
3300006196\|Ga0075422_10048368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Filomicrobium insigne	1534	Open in IMG/M
3300006358\|Ga0068871_101214342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	707	Open in IMG/M
3300006844\|Ga0075428_100136182	All Organisms → cellular organisms → Bacteria	2670	Open in IMG/M
3300006852\|Ga0075433_10003351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12384	Open in IMG/M
3300006852\|Ga0075433_10251082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1569	Open in IMG/M
3300006852\|Ga0075433_10322482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1367	Open in IMG/M
3300006852\|Ga0075433_10433357	Not Available	1159	Open in IMG/M
3300006871\|Ga0075434_100843521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	932	Open in IMG/M
3300006904\|Ga0075424_102081340	Not Available	598	Open in IMG/M
3300009094\|Ga0111539_10010044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11930	Open in IMG/M
3300009094\|Ga0111539_10270846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1976	Open in IMG/M
3300009094\|Ga0111539_10699527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1180	Open in IMG/M
3300009094\|Ga0111539_11505537	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300009094\|Ga0111539_12385205	Not Available	614	Open in IMG/M
3300009100\|Ga0075418_10451544	All Organisms → cellular organisms → Bacteria	1377	Open in IMG/M
3300009100\|Ga0075418_12167543	Not Available	606	Open in IMG/M
3300009100\|Ga0075418_12241090	Not Available	596	Open in IMG/M
3300009146\|Ga0105091_10126515	Not Available	1187	Open in IMG/M
3300009156\|Ga0111538_11104733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1003	Open in IMG/M
3300009156\|Ga0111538_12858613	Not Available	604	Open in IMG/M
3300009168\|Ga0105104_10606010	Not Available	623	Open in IMG/M
3300009987\|Ga0105030_128537	Not Available	515	Open in IMG/M
3300010043\|Ga0126380_10022341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3062	Open in IMG/M
3300010043\|Ga0126380_10152763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1481	Open in IMG/M
3300010043\|Ga0126380_11279411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	637	Open in IMG/M
3300010046\|Ga0126384_10000111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35873	Open in IMG/M
3300010047\|Ga0126382_10057761	All Organisms → cellular organisms → Bacteria	2311	Open in IMG/M
3300010047\|Ga0126382_10295486	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213	Open in IMG/M
3300010047\|Ga0126382_10690498	Not Available	855	Open in IMG/M
3300010047\|Ga0126382_10730434	Not Available	835	Open in IMG/M
3300010047\|Ga0126382_11022703	Not Available	726	Open in IMG/M
3300010360\|Ga0126372_10316768	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300010360\|Ga0126372_10705228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	986	Open in IMG/M
3300010362\|Ga0126377_10110064	All Organisms → cellular organisms → Bacteria	2528	Open in IMG/M
3300010362\|Ga0126377_10366068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1443	Open in IMG/M
3300010362\|Ga0126377_10928816	Not Available	934	Open in IMG/M
3300010362\|Ga0126377_12838272	Not Available	559	Open in IMG/M
3300010362\|Ga0126377_13095481	Not Available	537	Open in IMG/M
3300010398\|Ga0126383_12327755	Not Available	621	Open in IMG/M
3300010400\|Ga0134122_10007932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7915	Open in IMG/M
3300010868\|Ga0124844_1320901	Not Available	510	Open in IMG/M
3300012496\|Ga0157353_1035255	Not Available	552	Open in IMG/M
3300015371\|Ga0132258_10136080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5868	Open in IMG/M
3300015371\|Ga0132258_11376453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1783	Open in IMG/M
3300015372\|Ga0132256_102123338	Not Available	667	Open in IMG/M
3300025905\|Ga0207685_10549350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	614	Open in IMG/M
3300025937\|Ga0207669_11800225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	523	Open in IMG/M
3300026067\|Ga0207678_11797248	Not Available	537	Open in IMG/M
3300026118\|Ga0207675_100276872	All Organisms → cellular organisms → Bacteria	1629	Open in IMG/M
3300027646\|Ga0209466_1108385	Not Available	564	Open in IMG/M
3300027787\|Ga0209074_10142989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	853	Open in IMG/M
3300027907\|Ga0207428_10021995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5387	Open in IMG/M
3300027907\|Ga0207428_10310462	Not Available	1166	Open in IMG/M
3300027907\|Ga0207428_10414226	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300027907\|Ga0207428_10457138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	930	Open in IMG/M
3300031677\|Ga0307480_1008049	Not Available	698	Open in IMG/M
3300031677\|Ga0307480_1008959	Not Available	675	Open in IMG/M
3300031677\|Ga0307480_1024266	Not Available	504	Open in IMG/M
3300031720\|Ga0307469_10068843	All Organisms → cellular organisms → Bacteria	2334	Open in IMG/M
3300031740\|Ga0307468_100042499	Not Available	2295	Open in IMG/M
3300031740\|Ga0307468_100262292	Not Available	1224	Open in IMG/M
3300031820\|Ga0307473_10378776	All Organisms → cellular organisms → Bacteria	920	Open in IMG/M
3300031820\|Ga0307473_10588168	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300031858\|Ga0310892_10556713	Not Available	771	Open in IMG/M
3300032075\|Ga0310890_11235941	Not Available	609	Open in IMG/M
3300032174\|Ga0307470_10204140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1266	Open in IMG/M
3300032174\|Ga0307470_10926227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	687	Open in IMG/M
3300032180\|Ga0307471_101283592	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300032205\|Ga0307472_100399086	All Organisms → cellular organisms → Bacteria	1149	Open in IMG/M
3300032205\|Ga0307472_100913175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	814	Open in IMG/M
3300034818\|Ga0373950_0117692	Not Available	585	Open in IMG/M
3300034820\|Ga0373959_0090668	Not Available	716	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.74%
Host-Associated	Host-Associated	34.26%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.89%
Plants	Host-Associated → Plants	34.26%
Aquatic	Environmental → Aquatic	1.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.93%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.41%
Freshwater	Environmental → Aquatic → Freshwater	1.85%
Roots	Host-Associated → Plants → Roots	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.19%
Loam	Environmental → Terrestrial → Soil → Loam	28.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	21.30%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.56%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.63%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.85%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	25.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	21.30%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.63%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	25.00%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	20.37%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	15.74%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	12.04%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	3.70%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.85%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	1.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.93%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300012496	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300031677	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Host-Associated	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiFebDRAFT_127627832	3300000363	Soil	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS*
F24TB_100703052	3300000550	Soil	MKTVISALVALSILSGYSASAFADKVPQSIWEQLDREGRGGHPT*
JGI10213J12805_100066124	3300000858	Soil	MKTVLSALIALSVLSGFAASASADRVPQSIWEQLDRDGRGGHPT*
Ga0066397_101293742	3300004281	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHPG*
Ga0062595_1007976561	3300004479	Soil	MKTLICAVVALSVLSGYAGSAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066388_1000069116	3300005332	Tropical Forest Soil	MKTLMSALVALAVLAGSAASALADKVPPSIWEQLDREGHSISG*
Ga0066388_1004609662	3300005332	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHAG*
Ga0066388_1006613231	3300005332	Tropical Forest Soil	MKRIMSGLLALSVLLGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066388_1022035073	3300005332	Tropical Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066388_1024169662	3300005332	Tropical Forest Soil	VEDPAIKALLSTVLALSLLSGYAASALADKVPQSIWDELDRDGRGGHPT*
Ga0066388_1025666721	3300005332	Tropical Forest Soil	MKTVISALVALSVLSGYAASALADKVPQSIWEQLDRDGRGGHPT*
Ga0066388_1031575212	3300005332	Tropical Forest Soil	MKRLLSALVALSVVSGYAATALADQVPQSIWEQLDSDGRGGHPT*
Ga0066388_1059486522	3300005332	Tropical Forest Soil	MKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGG
Ga0066388_1082136251	3300005332	Tropical Forest Soil	MKMIVSAFLALSVLTGYAASALADKVPPAILEQLDREGHAS*
Ga0066388_1087762281	3300005332	Tropical Forest Soil	MKTLISALVALSVLSGYAASAMADKVPPSIWEQLDREGRGGHPT*
Ga0070691_100066587	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALVALSALSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066905_1000008366	3300005713	Tropical Forest Soil	MKAILSALVALSVLSGTAGSALADKVPASIWEQLDRDGH*
Ga0066905_1000034354	3300005713	Tropical Forest Soil	MQTLISALVALSILSGSAASALADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1000329083	3300005713	Tropical Forest Soil	MKMMISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1001338291	3300005713	Tropical Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGR
Ga0066905_1001798093	3300005713	Tropical Forest Soil	MKTLISALLALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPS*
Ga0066905_1001861213	3300005713	Tropical Forest Soil	MKMLISGLVALSVLSGYGASALADKVPQSIWEQLDRDGRGGHLI*
Ga0066905_1002397522	3300005713	Tropical Forest Soil	MKTLLSALVALSVVSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066905_1003667804	3300005713	Tropical Forest Soil	MKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0066905_1004700302	3300005713	Tropical Forest Soil	MKTLISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1011185231	3300005713	Tropical Forest Soil	SGTMQTLISALVALSILSGSAAPALADKVPQSIWEQLDWDGRGGHPT*
Ga0066905_1023038251	3300005713	Tropical Forest Soil	MKTLISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0068861_1001234593	3300005719	Switchgrass Rhizosphere	MKRIISALLVLSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066903_1002852754	3300005764	Tropical Forest Soil	LRRIAIKALFCVLLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0066903_1003010704	3300005764	Tropical Forest Soil	MKRLLSALVALSVVSGYAATALADQVPQSIWEQLDREGRGGHPT*
Ga0066903_1013793341	3300005764	Tropical Forest Soil	IEAVVISGLLALSVLSGYAGSAMADKVPPSIWERLDRDGRGGHPT*
Ga0081455_1000041219	3300005937	Tabebuia Heterophylla Rhizosphere	MQTLISALVALSVLSGSAASALADKVPPSIWEQLDRDGRGGHPT*
Ga0081455_1000099450	3300005937	Tabebuia Heterophylla Rhizosphere	MQTLISALVALSILSGSAASALADKVPRSIWEQLDWDGRGGHPT*
Ga0081540_100020537	3300005983	Tabebuia Heterophylla Rhizosphere	MKMIVSALLALSVLSGYAASALADKVPPAIWEQLDRDGHPT*
Ga0081540_10005157	3300005983	Tabebuia Heterophylla Rhizosphere	MKTMISALVVLSVLSGYAASAFADKVPKSIWEQLDREGYGGDSTIS*
Ga0070715_101849962	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT*
Ga0075422_100483683	3300006196	Populus Rhizosphere	ALKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0068871_1012143421	3300006358	Miscanthus Rhizosphere	SALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT*
Ga0075428_1001361823	3300006844	Populus Rhizosphere	MKTVISALVALSILSGYSASAFADKVPQSIWEQLDREGHGGHPT*
Ga0075433_100033515	3300006852	Populus Rhizosphere	MKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0075433_102510822	3300006852	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDGRGGHPT*
Ga0075433_103224823	3300006852	Populus Rhizosphere	MKAVLSAFVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0075433_104333572	3300006852	Populus Rhizosphere	MKRIISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0075434_1008435211	3300006871	Populus Rhizosphere	VLSAFVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0075424_1020813402	3300006904	Populus Rhizosphere	MKTLMSVLVTLAVLSGSTASALADKVPPSIWEQLDREGHSHSG*
Ga0111539_100100445	3300009094	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0111539_102708461	3300009094	Populus Rhizosphere	HAQRRNTMKTLICAVVALSVLSGYAGSAMADKVPPSIWEQLDRDGRGGHPT*
Ga0111539_106995271	3300009094	Populus Rhizosphere	MKTVISALVALSVVSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0111539_115055372	3300009094	Populus Rhizosphere	SALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS*
Ga0111539_123852052	3300009094	Populus Rhizosphere	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDREGRGGHP
Ga0075418_104515441	3300009100	Populus Rhizosphere	MKTLLSAFLALSVLSGYAATAMADKVPPSIWEQLDRDGRGSHPT*
Ga0075418_121675431	3300009100	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRG
Ga0075418_122410902	3300009100	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDG
Ga0105091_101265152	3300009146	Freshwater Sediment	MKTLVAALVALSVLSGYAASALADKVPQSIWEQLDRDGRGGRPT*
Ga0111538_111047333	3300009156	Populus Rhizosphere	MKTLLSAFLALSVLSGYAAKAMADKVPPSIWEQLDRDGRGGHPT*
Ga0111538_128586132	3300009156	Populus Rhizosphere	LSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA*
Ga0105104_106060101	3300009168	Freshwater Sediment	MKTVISALVALSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA*
Ga0105030_1285372	3300009987	Switchgrass Rhizosphere	MIMRTIVSALVALSVLSGSAAVAFAEKAPRSIWEQLDREGRGGTTT*
Ga0126380_100223415	3300010043	Tropical Forest Soil	MLAARAQIRRNAMKMLISGLVALSVLSGYGASALADKVPQSIWEQLDRDGRGGHLI*
Ga0126380_101527633	3300010043	Tropical Forest Soil	MKTLISALLALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0126380_112794111	3300010043	Tropical Forest Soil	LRRIAIKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0126384_1000011132	3300010046	Tropical Forest Soil	MKALLSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0126382_100577616	3300010047	Tropical Forest Soil	LRIIAMKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0126382_102954862	3300010047	Tropical Forest Soil	MKMIVSAFLALSVLTGYAASALADKVPPAIWEQLDREGHAS*
Ga0126382_106904981	3300010047	Tropical Forest Soil	MKTLIPALLALSVLLSVLGTLSVLSGYAASALADKVPPSIWEQLDRDGHPG*
Ga0126382_107304343	3300010047	Tropical Forest Soil	ALSVLLGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0126382_110227031	3300010047	Tropical Forest Soil	MKTILSALVALAVLSGSAASALADKVPASIWEQLDREGHSRSS*
Ga0126372_103167682	3300010360	Tropical Forest Soil	MSMKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHAG*
Ga0126372_107052282	3300010360	Tropical Forest Soil	MKTVISALVALSVLSGYAASALADKVPQSIWEQLDREGRGGHPT*
Ga0126377_101100643	3300010362	Tropical Forest Soil	MKIMISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0126377_103660682	3300010362	Tropical Forest Soil	MKTLMSGLVALAVLSASAASALADKVPQSIWEQLDREGHARSN*
Ga0126377_109288162	3300010362	Tropical Forest Soil	MKMVISGLVALSVLSGYGALALADKVPQSIWEQLDRDGRGGRLN*
Ga0126377_128382722	3300010362	Tropical Forest Soil	MKAILSALVTLSVLLGTTAAALADKVPPSIWEQLDRDGHGGRPT*
Ga0126377_130954811	3300010362	Tropical Forest Soil	LMSVLVALAVLSASAAAALADKVPQSIWEQLDREGHGRSN*
Ga0126383_123277552	3300010398	Tropical Forest Soil	MKTIISALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT*
Ga0134122_100079326	3300010400	Terrestrial Soil	MKTLISAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT*
Ga0124844_13209011	3300010868	Tropical Forest Soil	LVSVLAGLAILSGYAASVLADKVPPSIWEQLDRDGHAG*
Ga0157353_10352553	3300012496	Unplanted Soil	MSALLALSVVSGYAATALADTVPQSIWEQLDREGRGGHPT*
Ga0132258_101360805	3300015371	Arabidopsis Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVTDLS*
Ga0132258_113764534	3300015371	Arabidopsis Rhizosphere	MKSVISALVALSVLSGYAASAAADKVPQSIWEQLDREGRGGHPT*
Ga0132256_1021233383	3300015372	Arabidopsis Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAV
Ga0207685_105493502	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT
Ga0207669_118002251	3300025937	Miscanthus Rhizosphere	MKTVISALVALSALSGYAASAFADKVPQSIWEQLDREGRGGHPT
Ga0207678_117972481	3300026067	Corn Rhizosphere	MKTLISAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT
Ga0207675_1002768723	3300026118	Switchgrass Rhizosphere	MKRIISALLVLSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
Ga0209466_11083852	3300027646	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHPG
Ga0209074_101429893	3300027787	Agricultural Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT
Ga0207428_100219955	3300027907	Populus Rhizosphere	MKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT
Ga0207428_103104622	3300027907	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDGRGGHPT
Ga0207428_104142262	3300027907	Populus Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS
Ga0207428_104571383	3300027907	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT
Ga0307480_10080493	3300031677	Hardwood Forest Soil	MKTIMSALLALSVVSGYAATALADTVPQSIWEQLDRDGHGAVTDLS
Ga0307480_10089594	3300031677	Hardwood Forest Soil	MKTVVSALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT
Ga0307480_10242663	3300031677	Hardwood Forest Soil	MKTVISALVALSVVSGYAASAFADKVPQSIWEQHDRDGRGGHPT
Ga0307469_100688433	3300031720	Hardwood Forest Soil	MKTLLSAFLALSVLSGYAAKAMADKVPPSIWEQLDRDGRGGHPT
Ga0307468_1000424992	3300031740	Hardwood Forest Soil	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA
Ga0307468_1002622923	3300031740	Hardwood Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHLT
Ga0307473_103787761	3300031820	Hardwood Forest Soil	KTLISALLALSVLTASTASAMADKVPPWIWEQLDRDGHGAVTDLS
Ga0307473_105881683	3300031820	Hardwood Forest Soil	MKTLISALLALSVLTASTASAMADKVPPWIWEQLDRDGHGAVT
Ga0310892_105567133	3300031858	Soil	MKMLISAFLALSVLSGYAASALADKVPPSIWEQLDRDGRGGHPT
Ga0310890_112359412	3300032075	Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT
Ga0307470_102041401	3300032174	Hardwood Forest Soil	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDPEGRGGHPA
Ga0307470_109262272	3300032174	Hardwood Forest Soil	MKTVISALVALSVVSGYAASAFADKVPQSIWEQLDRDGRGGHPT
Ga0307471_1012835923	3300032180	Hardwood Forest Soil	MKTLFSAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT
Ga0307472_1003990862	3300032205	Hardwood Forest Soil	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVTDLS
Ga0307472_1009131752	3300032205	Hardwood Forest Soil	MSALLALSVVSGYAATALADTVPQSIWEQLDREGRGGHPT
Ga0373950_0117692_196_330	3300034818	Rhizosphere Soil	MKTLICTVVALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
Ga0373959_0090668_7_117	3300034820	Rhizosphere Soil	VALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F090934

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences