Basic Information | |
---|---|
Family ID | F091006 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 38 residues |
Representative Sequence | MGLRFEEINPPKKEECPMPPAKKTTKKAKSSKVEESTNS |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 2.78 % |
% of genes near scaffold ends (potentially truncated) | 15.74 % |
% of genes from short scaffolds (< 2000 bps) | 71.30 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (83.333 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.815 % of family members) |
Environment Ontology (ENVO) | Unclassified (82.407 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.222 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.97% β-sheet: 0.00% Coil/Unstructured: 94.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF13264 | DUF4055 | 50.00 |
PF01391 | Collagen | 4.63 |
PF03237 | Terminase_6N | 1.85 |
PF13481 | AAA_25 | 0.93 |
PF16778 | Phage_tail_APC | 0.93 |
PF13550 | Phage-tail_3 | 0.93 |
PF13884 | Peptidase_S74 | 0.93 |
PF12705 | PDDEXK_1 | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 83.33 % |
All Organisms | root | All Organisms | 16.67 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.81% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.52% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.33% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.56% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.70% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.70% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.78% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.78% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.78% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.78% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.85% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.93% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.93% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.93% |
Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.93% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.93% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
3300020360 | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165) | Environmental | Open in IMG/M |
3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_100549532 | 3300000116 | Marine | MAGLRFEEINPPKKEECPMPPAKKVTKKAKSSKVEESTNS* |
DelMOSpr2010_100714622 | 3300000116 | Marine | MGLRFEEINPPKKEECPMPPAKKTTKKAKSSKVEESTNS* |
DelMOSpr2010_101414312 | 3300000116 | Marine | MAGLRFEEINPPKKEESPTPSAKKATRKAKSSKVEESTNS* |
DelMOWin2010_100130876 | 3300000117 | Marine | MAGMRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS* |
BB_Man_B_Liq_inBBDRAFT_10157102 | 3300000401 | Bioluminescent Bay | MGLRFEEINPPKKEEKPAAKKPTSRKAKASKVEE* |
BBAY94_100583682 | 3300000949 | Macroalgal Surface | MGLRFEEINPPKKEEKPATAKKTSTKSTKSSKVEKSTDS* |
JGI24006J15134_100196323 | 3300001450 | Marine | MGLRFEEINPPKKEGSSASAEKKETKKAKSSKVEE* |
JGI24006J15134_100621462 | 3300001450 | Marine | MAEMRFEEINPPKKEESSSAKKTSKKEKATKVEESTNS* |
JGI24006J15134_100769762 | 3300001450 | Marine | MGLRFEEINPPKKEESSSSAAKKETKKAKSSKVEE* |
JGI24006J15134_100856752 | 3300001450 | Marine | MAGLRFEEINPPKKEECPMPPAKKETKKAKSSKVEESTNS* |
JGI24006J15134_102280002 | 3300001450 | Marine | MAGLRFEDINPPKKEECPMPPAKKVTKKAKSSKVEESTNS* |
JGI24004J15324_101540921 | 3300001472 | Marine | MGLRFEEINPPKKEGSSASTAKKETKKAKSSKVEE* |
GOS2249_10479892 | 3300001951 | Marine | MGLRFEEINPPKKEEKPAAKKPAAKKAKDSKVEE* |
GOS2229_10130992 | 3300001963 | Marine | MAGLRFEEINPPKKEESPTRSAKKATRKAKSSKVEESTNS* |
GOS2243_10248013 | 3300001965 | Marine | MGMRFEEINPPKKGECPMPEPKKTTKQAKSSKVEKSTNS* |
Ga0055584_1000134207 | 3300004097 | Pelagic Marine | MAGLRFEDINPPKKEEGPTPPVKKVTKKAKSSKVEESTNS* |
Ga0073579_15761072 | 3300005239 | Marine | MAGLRFEELNPPKKEEPVAPSPKKTTKRAKSSKVEESTNS* |
Ga0073579_16724122 | 3300005239 | Marine | MAGLRFEEINPPKKEESPASPAKKTTKKAKSSKVEESTNS* |
Ga0066370_100251722 | 3300005971 | Marine | MGLRFEEINPPKKEEKPAAKKPAAKKAKASKVEE* |
Ga0075478_100000349 | 3300006026 | Aqueous | MGLRFEEINPPKKEEAPAKKPAARKTKSTKVEESTDSN* |
Ga0098038_100152522 | 3300006735 | Marine | MGMRFEEINPPKKEECPMPEPKKTTKQAKSSKVEKSTNS* |
Ga0098038_100169822 | 3300006735 | Marine | MGMRFEEINPPKKEECPMPEPKKATKKAKSSKVDESTKA* |
Ga0098038_10089892 | 3300006735 | Marine | MGLRFEEINPPKKEECPMPATKKETKKAKSSKVEE* |
Ga0098038_10256202 | 3300006735 | Marine | MAGMRFEEINPPKKEECSLPAKKTSKKEKATKVEESTNS* |
Ga0098038_10700822 | 3300006735 | Marine | MGMRFEELNPPKKEQCPMPEPKKTTKKAKSSKVEESTNS* |
Ga0098038_10786592 | 3300006735 | Marine | MGLRFEEINPPKKEECPMPAAKKETKKAKSSKVEE* |
Ga0098038_11046072 | 3300006735 | Marine | MGLRFEEINPPKKEGSSAPAAKKETKKAKSSKVEE* |
Ga0098038_11104762 | 3300006735 | Marine | MGLRFEEINPPKKEGSSTPAAKKETKKAKSSKVEE* |
Ga0098038_11292022 | 3300006735 | Marine | MGMRFEELNPPKSQECPMPEPKKTTKKAKSSKVDESTKD* |
Ga0098038_11741542 | 3300006735 | Marine | MGMRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTNS* |
Ga0098038_11987741 | 3300006735 | Marine | MGLRFEEINPPKKEGSSAPAAKKETKKAKASKVEE* |
Ga0098038_12832912 | 3300006735 | Marine | MGMRFEEINPPKSQECPMPEPKKTTKKAKSSKVDESTKD* |
Ga0098037_11735892 | 3300006737 | Marine | MGMRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTKS* |
Ga0098042_10420802 | 3300006749 | Marine | MGMRFEEINPPKNQECPMPEPKKAAKKAKSSKVDESTKD* |
Ga0098042_10790361 | 3300006749 | Marine | MGMRFEEINPPKKEECPMPEPKKTTKQAKSSKVEKSTKS* |
Ga0098042_10943292 | 3300006749 | Marine | MGMRFEEINPPKKGECPMPEPKKTTKQAKSSKVEKSTDS* |
Ga0098042_11263651 | 3300006749 | Marine | MGMRFEEINPPKKDECPMPEPKKTTKKAKSSKVEESTNS* |
Ga0098048_10394722 | 3300006752 | Marine | MGLRFEEINPPKKEEKPAAKKPAAKKAKDSKVAE* |
Ga0070748_11415862 | 3300006920 | Aqueous | MGLRFEEINPPKKEGSSAAAAKKETKKAKSSKVEE* |
Ga0098036_10202173 | 3300006929 | Marine | MGMRFEEINPPKNQECPMPEPKKAAKKAKSSKVEESTKD* |
Ga0070747_12885802 | 3300007276 | Aqueous | MGLRFEEINPPKKEGSSTSAAKKETKKAKSSKVEE* |
Ga0070752_13641801 | 3300007345 | Aqueous | NSFLIMAGLRFEEINPPKKEESPTPSAKKATRKAKSSKVEESTNS* |
Ga0102817_10668672 | 3300007555 | Estuarine | MGLRFEEINPPKKEGSSASAAKKETKKAKSSKVEE* |
Ga0102855_11993142 | 3300007647 | Estuarine | RVATHQAMAEMRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS* |
Ga0105737_10555762 | 3300007862 | Estuary Water | MAEMRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS* |
Ga0115013_113538102 | 3300009550 | Marine | VPMGMRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTKS* |
Ga0098043_10890922 | 3300010148 | Marine | MGMRFEEINPPKKEECPMPEPKKATKKAKSSKVDESTKD* |
Ga0098043_11221921 | 3300010148 | Marine | MGMRFEEINPPKNQECPMPEPKKATKKAKSSKVDESTKA* |
Ga0136549_100633782 | 3300010389 | Marine Methane Seep Sediment | MGLRFEEINPPKKEEKPAAKKPAAKKAKTSKVEE* |
Ga0160423_101828563 | 3300012920 | Surface Seawater | MGLRFEEINPPKKDECPMPAPKKTTKQAKSSKVEKSTKF* |
Ga0163109_101252011 | 3300012936 | Surface Seawater | PMGMRFEEINPPKNQECPMPEPKKTTKKVKPSKVDESTKK* |
Ga0163109_107531352 | 3300012936 | Surface Seawater | RFEEINPPKKEECPMPEPKKTTKQAKSSKVEKSTKS* |
Ga0181369_10723382 | 3300017708 | Marine | MAGLRFEEINPPKKEACPVPLAKKPTKKAKSSKVEESTNS |
Ga0181369_10874312 | 3300017708 | Marine | MGLRFEEINPPKKEECPMPAAKKQTKKAKSSKVEE |
Ga0181369_11230682 | 3300017708 | Marine | MGLRFEEINPPKKAGSSAPAAKKETKKAKSSKVEE |
Ga0181387_10698922 | 3300017709 | Seawater | MGMRFEEINPPKKDECPMPEPKKTTKQVKSSKVEKSTNS |
Ga0181387_10847791 | 3300017709 | Seawater | MAGMRFEEINPPKKEASSPARKTNKKEKATKVEESTNS |
Ga0181404_10092852 | 3300017717 | Seawater | MGMRFEEINPPKNQECPMPEPKKTTKKAKSSKVDESTKA |
Ga0181373_10681571 | 3300017721 | Marine | MGMRFEELNPPKKEQCPMPEPKKTTKKAKSSKVEES |
Ga0181401_10018439 | 3300017727 | Seawater | MAGLRFEEINPPKKEECPVPPAKKTTKKAKSSKVEESTNS |
Ga0181419_10881132 | 3300017728 | Seawater | MGLRFEEINPPKKEGSSTPAAKKETKKSKSSKVEE |
Ga0181426_10061982 | 3300017733 | Seawater | MAGMRFEEINPPKKEESSSTKKTSKKEKATKVEGSTNS |
Ga0181431_10512582 | 3300017735 | Seawater | MGLRFEEINPPKKAGSSASAAKKETKKAKSSKVEE |
Ga0181399_11419152 | 3300017742 | Seawater | MGLRFEEINPPKKEECPMPAAKKETKKDKSSKVEE |
Ga0181389_11848482 | 3300017746 | Seawater | PMGMRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTNS |
Ga0181400_12019531 | 3300017752 | Seawater | LRFEEINPPKKEECPMPPAKKTARKAKSSKVEESTNS |
Ga0181420_10088175 | 3300017757 | Seawater | MAGLRFEEINPPKKEECPMPPAKKTTKKAKSSKVEESTNS |
Ga0181408_10205372 | 3300017760 | Seawater | MGLRFEEINPHKKEGSSTPAAKKETKKAKSSKVEE |
Ga0181413_10473352 | 3300017765 | Seawater | MGMRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTNS |
Ga0181406_11092632 | 3300017767 | Seawater | MAGLRFEEINPPKKDECPMPEPKKTTKQAKSSKVEKSTNS |
Ga0181406_11597252 | 3300017767 | Seawater | VPMGMRFEEINPPKNQECPMPEPKKTAKKAKSSKVDESTKA |
Ga0187217_12020632 | 3300017770 | Seawater | ITALILMGLRFEEINPPKKEGSSASAAKKETKKAKSSKVEE |
Ga0181423_12983381 | 3300017781 | Seawater | MAGMRFEEINPPKKEASSPTKKTSKKEKATKVEESTNS |
Ga0181424_1000007522 | 3300017786 | Seawater | MGMRFEEINPPKNQECPMPEPKKTTKKVKPSKVDESTKK |
Ga0181424_100752063 | 3300017786 | Seawater | VMGLRFEEINPPKKEGSSASAAKKETKKAKSSKVEE |
Ga0181577_102642073 | 3300017951 | Salt Marsh | MGLRFEEINPPKKEEKPAATQKAATKKAKDSKVAE |
Ga0181563_1000389729 | 3300018420 | Salt Marsh | MGLRFEEINPPKKEEKPAVKKTTATKKTKSSKVAESTDS |
Ga0211529_10121002 | 3300020258 | Marine | MGLRFEEINPPKKEDKSAAAKKTATKKTKSSKVDE |
Ga0211712_100990612 | 3300020360 | Marine | MGMRFEEINPPKKEECPMPEPKKTTKQAKSSKVEKSTKS |
Ga0211527_100144323 | 3300020378 | Marine | MGLRFEEINPPKSQECPMPEPKKTTKKAKPSKVNESTKD |
Ga0211677_100152785 | 3300020385 | Marine | MGLRFEEINPPKKEGSPAPAAKKETKKAKSSKVEE |
Ga0211678_103593831 | 3300020388 | Marine | VMGLRFEEINPPKKEGSSAPAAKKETKKAKSSKVEE |
Ga0211554_1000315711 | 3300020431 | Marine | MGLRFEEINPPKKEGSSASAAKKETKKAKSSKVEE |
Ga0211576_100044906 | 3300020438 | Marine | MGLRFEEINPPKKEECPMPATKKETKKAKSSKVEE |
Ga0211473_102647282 | 3300020451 | Marine | MGLRFEEINPPKKEGSSASTAKKETKKAKSSKVEE |
Ga0213858_100028884 | 3300021356 | Seawater | MGLRFEEINPPKKEEKPAAKKPATKKAKSSTVEKSTNS |
Ga0213858_102058681 | 3300021356 | Seawater | IPMGLRFEEINPPKKEEKPAAKKPAAKKAKASKVEE |
Ga0213859_100982952 | 3300021364 | Seawater | MGLRFEEINPPKKEEKPAAKKPAAKKAKTSTVEESTNS |
Ga0213865_101800462 | 3300021373 | Seawater | MAGMRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS |
Ga0222718_1000177529 | 3300021958 | Estuarine Water | MAGLRFEEINPPKKEECPTPPAKRVTKKAKSSKVEESTNS |
Ga0224902_1089522 | 3300022066 | Seawater | RGVIRSNLMGLRFEEINPPKKEEKPATAKKTSTKSTKSSKVEKSTDS |
Ga0196895_10003966 | 3300022067 | Aqueous | MGLRFEEINPPKKEEAPAKKPAARKTKSTKVEESTDSN |
Ga0255773_103460842 | 3300022925 | Salt Marsh | KRLFIMGLRFEEINPPKKEEKPAAKKPAAKKAKDSKVEE |
Ga0244775_106488752 | 3300024346 | Estuarine | MGLRFEEINPPKKEESSASAAKKETKKAKSSKVEE |
Ga0208157_10010798 | 3300025086 | Marine | MGLRFEEINPPKKEECPMPAAKKETKKAKSSKVEE |
Ga0208157_10014973 | 3300025086 | Marine | MGMRFEEINPPKKEECPMPEPKKTTKQAKSSKVEKSTNS |
Ga0208157_10614762 | 3300025086 | Marine | MGLRFEEINPPKKEGSSAPAAKKETKKAKASKVEE |
Ga0208159_10416482 | 3300025101 | Marine | MGMRFEELNPPKKEQCPMPEPKKTTKKAKSSKVEESTNS |
Ga0208666_100012225 | 3300025102 | Marine | MGMRFEEINPPKKEECPMPEPKKATKKAKSSKVDESTKA |
Ga0208666_10025368 | 3300025102 | Marine | MGMRFEEINPPKKGECPMPEPKKTTKQAKSSKVEKSTNS |
Ga0209535_10323752 | 3300025120 | Marine | MAGLRFEEINPPKKEECPMPPAKKETKKAKSSKVEESTNS |
Ga0209535_11064122 | 3300025120 | Marine | MAEMRFEEINPPKKEESSSAKKTSKKEKATKVEESTNS |
Ga0209232_11541512 | 3300025132 | Marine | MGLRFEEINPPKKEEKPATAKKTSTKSTKSSKVEKSTDS |
Ga0209337_10021852 | 3300025168 | Marine | MGLRFEEINPPKKEGSSASAEKKETKKAKSSKVEE |
Ga0208544_100131893 | 3300025887 | Aqueous | MRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS |
Ga0257110_10204773 | 3300028197 | Marine | MAEMRFEEINPPKKEESSPAKKTSKKEKATKVEESTNS |
Ga0183748_100018827 | 3300029319 | Marine | MGLRFEEINPPKKEEKPAVKKTTATKKTKTSKVAESTDS |
Ga0314858_036542_556_678 | 3300033742 | Sea-Ice Brine | MAGLRFEDINPPKKEECPMPPAKKVTKKAKSSKVEESTNS |
⦗Top⦘ |