NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091082

Metagenome Family F091082

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091082
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 46 residues
Representative Sequence MRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSLMKN
Number of Associated Samples 25
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 72.90 %
% of genes near scaffold ends (potentially truncated) 69.16 %
% of genes from short scaffolds (< 2000 bps) 57.01 %
Associated GOLD sequencing projects 25
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.262 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(59.813 % of family members)
Environment Ontology (ENVO) Unclassified
(98.131 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(86.916 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.94%    β-sheet: 0.00%    Coil/Unstructured: 43.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07727RVT_2 10.28
PF00067p450 2.80
PF08263LRRNT_2 0.93
PF13639zf-RING_2 0.93
PF03953Tubulin_C 0.93
PF05938Self-incomp_S1 0.93
PF12776Myb_DNA-bind_3 0.93
PF14223Retrotran_gag_2 0.93
PF05970PIF1 0.93
PF04959ARS2 0.93
PF01055Glyco_hydro_31 0.93
PF00122E1-E2_ATPase 0.93
PF14111DUF4283 0.93
PF12854PPR_1 0.93
PF01657Stress-antifung 0.93
PF03732Retrotrans_gag 0.93
PF07859Abhydrolase_3 0.93
PF13976gag_pre-integrs 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 2.80
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.93
COG0507ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.93
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.93
COG1501Alpha-glucosidase/xylosidase, GH31 familyCarbohydrate transport and metabolism [G] 0.93
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.93
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.26 %
UnclassifiedrootN/A3.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10004209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida22182Open in IMG/M
3300028786|Ga0307517_10035863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5599Open in IMG/M
3300028786|Ga0307517_10037927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5360Open in IMG/M
3300028786|Ga0307517_10052665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4072Open in IMG/M
3300028786|Ga0307517_10199517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1253Open in IMG/M
3300028786|Ga0307517_10220275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1154Open in IMG/M
3300028786|Ga0307517_10269145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta981Open in IMG/M
3300028786|Ga0307517_10651163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus512Open in IMG/M
3300028794|Ga0307515_10007543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta21491Open in IMG/M
3300028794|Ga0307515_10049529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae6315Open in IMG/M
3300028794|Ga0307515_10077438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4391Open in IMG/M
3300028794|Ga0307515_10091457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3801Open in IMG/M
3300028794|Ga0307515_10117979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3032Open in IMG/M
3300028794|Ga0307515_10309672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1255Open in IMG/M
3300030521|Ga0307511_10048764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3440Open in IMG/M
3300030521|Ga0307511_10182687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa1126Open in IMG/M
3300030521|Ga0307511_10369673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus605Open in IMG/M
3300030522|Ga0307512_10275081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa811Open in IMG/M
3300030522|Ga0307512_10397674All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus580Open in IMG/M
3300031456|Ga0307513_10068537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3715Open in IMG/M
3300031456|Ga0307513_10373349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1168Open in IMG/M
3300031456|Ga0307513_10845795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta621Open in IMG/M
3300031507|Ga0307509_10250901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1553Open in IMG/M
3300031507|Ga0307509_10349491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1202Open in IMG/M
3300031507|Ga0307509_10362503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1168Open in IMG/M
3300031507|Ga0307509_10486929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta920Open in IMG/M
3300031507|Ga0307509_10510981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta884Open in IMG/M
3300031507|Ga0307509_10641465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus731Open in IMG/M
3300031507|Ga0307509_10668438Not Available706Open in IMG/M
3300031616|Ga0307508_10056544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3474Open in IMG/M
3300031616|Ga0307508_10136623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2055Open in IMG/M
3300031616|Ga0307508_10218558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1505Open in IMG/M
3300031616|Ga0307508_10288593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1234Open in IMG/M
3300031616|Ga0307508_10432185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus908Open in IMG/M
3300031616|Ga0307508_10523806Not Available781Open in IMG/M
3300031616|Ga0307508_10683454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta634Open in IMG/M
3300031616|Ga0307508_10729661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta602Open in IMG/M
3300031616|Ga0307508_10861549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida528Open in IMG/M
3300031649|Ga0307514_10017744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5850Open in IMG/M
3300031649|Ga0307514_10042998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3550Open in IMG/M
3300031649|Ga0307514_10165716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1454Open in IMG/M
3300031649|Ga0307514_10180825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1360Open in IMG/M
3300031649|Ga0307514_10213807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1193Open in IMG/M
3300031649|Ga0307514_10368012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus754Open in IMG/M
3300031649|Ga0307514_10394373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus710Open in IMG/M
3300031730|Ga0307516_10049006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa4154Open in IMG/M
3300031730|Ga0307516_10107935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2591Open in IMG/M
3300031730|Ga0307516_10421538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus992Open in IMG/M
3300031730|Ga0307516_10721659Not Available654Open in IMG/M
3300031730|Ga0307516_10757711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus630Open in IMG/M
3300031730|Ga0307516_10796628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus606Open in IMG/M
3300031838|Ga0307518_10121434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1848Open in IMG/M
3300031838|Ga0307518_10140459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1685Open in IMG/M
3300031838|Ga0307518_10295882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae988Open in IMG/M
3300031838|Ga0307518_10362360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus835Open in IMG/M
3300031838|Ga0307518_10581496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus542Open in IMG/M
3300032354|Ga0325403_1003301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida14684Open in IMG/M
3300032354|Ga0325403_1006325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11259Open in IMG/M
3300032354|Ga0325403_1015624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7068Open in IMG/M
3300032354|Ga0325403_1036493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3908Open in IMG/M
3300032354|Ga0325403_1041828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3475Open in IMG/M
3300032354|Ga0325403_1058735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2462Open in IMG/M
3300032354|Ga0325403_1058783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2459Open in IMG/M
3300032354|Ga0325403_1083447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1566Open in IMG/M
3300032355|Ga0325401_1005222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus12388Open in IMG/M
3300032355|Ga0325401_1007254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10763Open in IMG/M
3300032355|Ga0325401_1052917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3054Open in IMG/M
3300032355|Ga0325401_1144017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta986Open in IMG/M
3300032374|Ga0325400_1219461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus811Open in IMG/M
3300032389|Ga0325405_1002558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae18721Open in IMG/M
3300032389|Ga0325405_1006093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae12204Open in IMG/M
3300032389|Ga0325405_1007756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10782Open in IMG/M
3300032389|Ga0325405_1037502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3445Open in IMG/M
3300032389|Ga0325405_1073541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1453Open in IMG/M
3300032389|Ga0325405_1080312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1246Open in IMG/M
3300032389|Ga0325405_1093585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus949Open in IMG/M
3300032390|Ga0325404_1037338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3448Open in IMG/M
3300032390|Ga0325404_1063627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1748Open in IMG/M
3300032390|Ga0325404_1079088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1193Open in IMG/M
3300032390|Ga0325404_1104667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus729Open in IMG/M
3300032735|Ga0325410_1056123All Organisms → cellular organisms → Eukaryota2086Open in IMG/M
3300032740|Ga0325411_1024845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales5182Open in IMG/M
3300033160|Ga0325402_1047365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3054Open in IMG/M
3300033179|Ga0307507_10048162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae4150Open in IMG/M
3300033179|Ga0307507_10104794Not Available2345Open in IMG/M
3300033179|Ga0307507_10148578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1771Open in IMG/M
3300033179|Ga0307507_10224782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1255Open in IMG/M
3300033179|Ga0307507_10466720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus691Open in IMG/M
3300033179|Ga0307507_10515009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta640Open in IMG/M
3300033180|Ga0307510_10184171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1646Open in IMG/M
3300033180|Ga0307510_10424223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta772Open in IMG/M
3300034389|Ga0325419_000301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida51737Open in IMG/M
3300034389|Ga0325419_000769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta34678Open in IMG/M
3300034389|Ga0325419_001269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus28365Open in IMG/M
3300034389|Ga0325419_003000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae19002Open in IMG/M
3300034389|Ga0325419_003526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta17604Open in IMG/M
3300034389|Ga0325419_012627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta8512Open in IMG/M
3300034389|Ga0325419_046428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2684Open in IMG/M
3300034389|Ga0325419_061994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1788Open in IMG/M
3300034389|Ga0325419_067139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1577Open in IMG/M
3300034389|Ga0325419_069981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1470Open in IMG/M
3300034389|Ga0325419_070425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1455Open in IMG/M
3300034688|Ga0325420_042506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3022Open in IMG/M
3300034688|Ga0325420_159237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus513Open in IMG/M
3300034689|Ga0325421_037890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3247Open in IMG/M
3300034817|Ga0373948_0103008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus674Open in IMG/M
3300034818|Ga0373950_0026531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1052Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza59.81%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem25.23%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf13.08%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_1000420943300028786EctomycorrhizaMRHGKEICNLQGRENKRQGNGVMLKMMTSKMTIDLNVLSSLIKN
Ga0307517_1003586313300028786EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSLM
Ga0307517_1003792713300028786EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSALMKN
Ga0307517_1005266513300028786EctomycorrhizaMQFDKEICNLLRRRNKRQNNSVMLEMMMNKMTIDLNVLGSFIKKS
Ga0307517_1019951713300028786EctomycorrhizaMRLGKEICNLQGRRNKRQNNGAMLEMMTSKMTIDLNVLSSLMKKRVVSNLNRTL
Ga0307517_1022027533300028786EctomycorrhizaMRLGKEICNLQERMNKRQSNGAMLEMMMSKITIDLDVLSSLIKIEL
Ga0307517_1026914513300028786EctomycorrhizaMKTRDGMRLGKEICNLQGKRNKRQSNGAMLEMITSKMTIDLNVLSSLMKNRVVSNLNGT
Ga0307517_1065116313300028786EctomycorrhizaMRLGKEIYNLQGRRNKRQSNGAMLKMITSKMKIDFNVFSSLMKN
Ga0307515_10007543383300028794EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNV
Ga0307515_1004952913300028794EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSLMKNRVVS
Ga0307515_1007743883300028794EctomycorrhizaMKTRYGMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNV
Ga0307515_1009145773300028794EctomycorrhizaMRLGKEICNLQRKRNKRQSNDALLEMMTSKMTIDLNMLSSFMKN
Ga0307515_1011797913300028794EctomycorrhizaMRLDKEICNLQGRRNKRQSNGVMLEMMTSKMTIDLNVLSSLMKNQVMSNLNRTRCYNT
Ga0307515_1030967213300028794EctomycorrhizaMRDEMRLGKEICNLQGRRNKRQGNGVMLEMMKSKMTIDLNVLSSLM
Ga0307511_1004876423300030521EctomycorrhizaMRLGKEICNLQGRMNKRQSNGVMLEMMTSKMTIDLNV
Ga0307511_1018268713300030521EctomycorrhizaMRLDKVIYNMQKRRNKRQSNGVMLEMMMSKMTLDLNVLSSFMKNRVVSNLNR
Ga0307511_1036967313300030521EctomycorrhizaMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTEL
Ga0307512_1027508123300030522EctomycorrhizaMRLGKEICNLHGRRNKRQSNGVMLEMMMNKMTIDLNMLS
Ga0307512_1039767413300030522EctomycorrhizaMRLGKEIWNLQGRRNKRQSNGAMLEMMTSKMTIDLNMLSSLMKNRVVS
Ga0307513_1006853713300031456EctomycorrhizaMRLGKEICNLQGRMNKRQSNGVMLEMMTNKMTIDLNVLSSLIKTEL
Ga0307513_1037334923300031456EctomycorrhizaLEKKTGNKMRLGKEICNLQRKRNKRQSNDALLEMMTSKMTIDLNMLSSFMKN
Ga0307513_1084579513300031456EctomycorrhizaLGKEICNLQGRRNKRQSNGVMLEMMTSKMTINLNVLSSFMKN
Ga0307509_1025090123300031507EctomycorrhizaMRLGKEICNLQGRRNKRQNNGAMFEMMTSKMTIDLNVLSALM
Ga0307509_1034949123300031507EctomycorrhizaMRLGKEICNLQGRMNKRQSNGVMLEMMTSKMTIDLNVLSSLI
Ga0307509_1036250323300031507EctomycorrhizaTRYGMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLISLIKTEL
Ga0307509_1048692913300031507EctomycorrhizaMKTGNGMRLDKGICNLQRRRNKRQSNGTMLEMMTSKMTIDLNV
Ga0307509_1051098123300031507EctomycorrhizaMECALVRNLQGRRNKRQGNGAMLEMMTSKMTIDLNVLSSLMKNRVVSN
Ga0307509_1064146513300031507EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVL
Ga0307509_1066843813300031507EctomycorrhizaMRLGIEIYNLQGRRNKRQSNGVMLEMMTSKMTIDLKVLSSLM
Ga0307508_1005654413300031616EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSA
Ga0307508_1013662313300031616EctomycorrhizaKKIYNLQRKRNKKQSNGVMLEMMMNKMEIDLNVRSSFIRN
Ga0307508_1021855813300031616EctomycorrhizaMRLDKEICNLQGRRNKRQSNGAMFEMLTSKMTIDLNVLSALMKNR
Ga0307508_1028859323300031616EctomycorrhizaMRLGKEIYNMQGRRNKRQSNGAMFEMMTSKMTIDLNVLSAFMKN
Ga0307508_1043218513300031616EctomycorrhizaMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLS
Ga0307508_1052380613300031616EctomycorrhizaMGLGIEIYNLQGRRNKRQSNGVMLEMMTSKMTIDLKVLSSLMK
Ga0307508_1068345423300031616EctomycorrhizaMQLGKEICNLQRRRNKRQSNGVMLEMMTSKMTIDLNVLSSFMKNRVVSNLN
Ga0307508_1072966123300031616EctomycorrhizaMQIGKEICNLQRRRNKRQSNGVMLEMMMSKITIVLNVLSLFMKN
Ga0307508_1086154913300031616EctomycorrhizaMLLGREICNLQIRRNKRQSNDVMFGMITNKMTIDLNMLSSF
Ga0307514_1001774413300031649EctomycorrhizaMRLGKEICNLQGRMNKRQSNGVILEMMTSKMTIDLNVLSSLIKTEL
Ga0307514_1004299863300031649EctomycorrhizaMRFGKEICNLQRRRNKGRNNCAMLEMITNKMTIDLNVLSSFMKK
Ga0307514_1016571613300031649EctomycorrhizaMRNGMRLGKEICNLQGRRNKRQSNGVMLEMMTSKMTINLNMFSS
Ga0307514_1018082543300031649EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSLMKN
Ga0307514_1021380723300031649EctomycorrhizaMRLGKEICNLQGKRNKRQSNGAILEMMTSKMTIDLNV
Ga0307514_1036801223300031649EctomycorrhizaKTRYGMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTEL
Ga0307514_1039437313300031649EctomycorrhizaMKTRDGMRLGKEICNLQGKMNKRQSNGVMLEMMTSKMTIDLNMLSS
Ga0307516_1004900653300031730EctomycorrhizaMRLGKEICNLQGRMNKRKSNDAMLEMMTSKMAIDLNVLSSLMKNRVVSN
Ga0307516_1010793513300031730EctomycorrhizaMLHSKEIYNLQRRKNKGQSNSVMLEIMTSKMTIDLNVLNSFMKNQVV
Ga0307516_1042153813300031730EctomycorrhizaMRNEMRLGKEICNLQGRRNKRQSNGVMLEMMTSKMTINLNM
Ga0307516_1072165913300031730EctomycorrhizaMXLGKEIYNLQRRINKRQSNGVRLEMMTSKMRIDLNVLSLFMKK
Ga0307516_1075771113300031730EctomycorrhizaMRDEMCLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDFNVLSS
Ga0307516_1079662813300031730EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSL
Ga0307518_1012143423300031838EctomycorrhizaMKTRYEMRLGKEICNLQGRTNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTE
Ga0307518_1014045913300031838EctomycorrhizaMRLGKEICNLQGRRNKRQRNGAMFEMMTSKMKIDLNVLSAL
Ga0307518_1029588213300031838EctomycorrhizaMRLGKEICNLQGRRNKRQSNGVMLEMMTSKMTINLNVLSSFMKN
Ga0307518_1036236023300031838EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSALMKNRVMSN
Ga0307518_1058149613300031838EctomycorrhizaMRLGKEICNLQGRRNKRQNNGAMLEMMTSKMTIDLNVLSSLMKKRVVS
Ga0325403_100330123300032354XylemMXHGKEICNLQGRENKRQSNGVVLKMMTSKMTIDLNVLNSLIKKLSYEQSE
Ga0325403_100632513300032354XylemMRLDKEICNLQGRMNKRQSNCVILEMMTSKMTIDLNVLSSLIKTEL
Ga0325403_101562443300032354XylemMRLGKEIYNLQGRMNKRQSNGAMLEMMTSKMTIDLNMLSSLIKTELLVI
Ga0325403_103649313300032354XylemMRLGKEIYNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSAL
Ga0325403_104182833300032354XylemMRLGKEICNLQGRMNKKQSNGAILEMMTSKMTIDLNVFSSLIKTEF
Ga0325403_105873513300032354XylemMRLGKEIYNLQGRRNKRQNNGAMFEMMTSKMTINLNVLSALMKNRVMSNL
Ga0325403_105878323300032354XylemMRLGKEICNPQGKRNKRQSNGVMLDMMTSKMTIDLNVLSSLIKKSSCEQSE
Ga0325403_108344713300032354XylemMRLGKEICNLQGRRNKRQNNGAMFEMMTSKMTIDLNVLSALMKNRVMSNLNRTLVVT
Ga0325401_1005222103300032355XylemMRLGKEICNLQGRSNKRQSNGIMREMMTSKMTIDLNVLSSLMKN
Ga0325401_100725453300032355XylemMRLGKEICNLQGRMNKRQSNGAILEMMTSKMTINLNVLSSLIKTEL
Ga0325401_105291733300032355XylemMRLGKEICNLQGRRNKRQSNGAMFEMMMSKMTIDLNVLSALMKNRVMSN
Ga0325401_114401723300032355XylemMCLGKEICNLQGRRNKRQSNGVMLEMMTSKMTIDLNVLSSLVK
Ga0325400_121946113300032374XylemMPLNKEICNLQGRRNKRQSNGVMFEMMTSKMTIDLNVLSALMKNRV
Ga0325405_100255813300032389XylemGMRLGKEICNLQGRMNKKQSNGAMLEMMTSKMTIDLNVLSSLLKNRVVSNLNRTIEL
Ga0325405_1006093163300032389XylemMRDGMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLS
Ga0325405_100775623300032389XylemMQLGKEIWNLQRRRNKRQSNGAVLEMMTSKMTIDLNVLSSFMKNRVVSN
Ga0325405_103750213300032389XylemMRLGKEIYNLQIRRNKNQINGVMLEMMTNKMEIDLNVRSSFIKN
Ga0325405_107354113300032389XylemMRLGKEICNLQGRMNKKQSNGAMLEMMTSKMTIDLNVLSS
Ga0325405_108031213300032389XylemMRLGKEICNLQGRRNKRQNNGAMFEMMTSKMTINLNVLSALM
Ga0325405_109358513300032389XylemMRLGKEICNLQGRRNKRQNNGAMFEMMTSKMTIDLNVLSALMKN
Ga0325404_103733813300032390XylemMRLGKEIYNLQIRRNKNQINSVMLEMMTNKMEIDLNVRSSFIKN
Ga0325404_106362713300032390XylemMRLDKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSALMKNRVMSNLNRTLVVT
Ga0325404_107908813300032390XylemMRLGKEICNLQGRRNKRQNNGAMFEMMTSKMTIDLNVLSALMKNR
Ga0325404_110466713300032390XylemMRLGKEICNLQGRRNKRQSNGVMFEMMTSKMTIDLNV
Ga0325410_105612343300032735XylemMRLGKEIYNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSALMKNRVMSNL
Ga0325411_102484513300032740XylemMRDGMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVLSALMKNRV
Ga0325402_104736543300033160XylemMHLGKEICNLQGRRNKRQSNGAMFEMMMSKMTIDLNVLSALMKNRVMSN
Ga0307507_1004816223300033179EctomycorrhizaMRLGKEICNLQGRMNKRQSNGAMLEMMTNKMTIDLNVLSSLIKTEL
Ga0307507_1010479413300033179EctomycorrhizaMKTRNRMRLDKEFCNLQKRINKRQSNGAMLEKMMSKIKIDLNVLTSLMKNRVVSNLNRT
Ga0307507_1014857833300033179EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNV
Ga0307507_1022478213300033179EctomycorrhizaMRLSKEICNLQRRRNKRKDNGVMLEMMMSKMTIDLNILSSFMKNRVVINPIGCHNT
Ga0307507_1046672023300033179EctomycorrhizaMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSSLMKNRV
Ga0307507_1051500913300033179EctomycorrhizaMRLDKVIYNMQKRRNKRQSNGVMLEMMMSKMTLDLN
Ga0307510_1018417143300033180EctomycorrhizaMRFGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTEL
Ga0307510_1042422313300033180EctomycorrhizaMRLGKEICKEEEIKGKDGAMLEMITSKMTIDLKVLSLLMKNRIVSSLNRTLVVTI
Ga0325419_000301_10587_107393300034389LeafMKTRVEMCLGKEICNMQGRRNKRQSNGAMLEMMTSKMTIDLNVLSLLMKN
Ga0325419_000769_17802_179423300034389LeafMRLGKEICNLQGRMNQRQSNGAMLEMMTSKMTIDLNVLSSLIKTEL
Ga0325419_001269_13513_136473300034389LeafMRLGKEICNLQGRRNKRQSNGAMLEMMTSKMTIDLNVLSLLMKN
Ga0325419_003000_18827_189973300034389LeafMRLGKEICNLQGRMNKKQSNGAMLEMMTSKMTIDLNVLSSLLKNRVVSNLNRTIEL
Ga0325419_003526_7091_72253300034389LeafMQFGKEICNLHGRRNKRQSNGAMLEMIMSKMTIDLNNSFMKNEL
Ga0325419_012627_4540_46923300034389LeafMRNGMRLGKEICNLQGRRRKRESNGVMLEMMMSKMTIDLNVLSSFMKTEL
Ga0325419_046428_885_10343300034389LeafMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTELLAI
Ga0325419_061994_1229_13693300034389LeafMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKIEL
Ga0325419_067139_1058_12133300034389LeafMRLGKEICNPQGKRNKRQSNGVMLEMMTSKMTIDLNVLSSLIKKSSCEQSE
Ga0325419_069981_924_10643300034389LeafMRLGKEICNLQGRMNKRQSNGVMLEMMTSKMTIDLNVLSSLIKTEL
Ga0325419_070425_407_5473300034389LeafMRLGKEIRNLQGRMNKRQSNGVMLEMMTSKMTIDLNVLSSLIKTEL
Ga0325420_042506_3_1373300034688LeafMRLGKEICNLQGRRNKRQSNGAMFEMMTSKMTIDLNVFNALMKN
Ga0325420_159237_1_1203300034688LeafMRLGKEICNLQGRKNKRQSSGAMFEMMTSKMTIDLNVLSA
Ga0325421_037890_744_9023300034689LeafMKMRNGIRLGKEICNLQERRNKRQSNGAMLEMMTSKMTIDLNVLSSLMKTEL
Ga0373948_0103008_126_2843300034817Rhizosphere SoilMKTRYGMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTIDLNVLSSLIKTEL
Ga0373950_0026531_3_1193300034818Rhizosphere SoilMGLGKEICNLQGRMNKRQSNGAMLEMMMSKITIDLDVLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.