NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091196

Metagenome Family F091196

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091196
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 183 residues
Representative Sequence MHDDERDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWALAVCAGILAVIALTLHFARAPLRQPTPSASLPQPATTQPAPPMVSRQQPLLSPRRPAGGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENTAGGLEIPRIIVAALQIKPLDDSQSEQGK
Number of Associated Samples 63
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.62 %
% of genes near scaffold ends (potentially truncated) 53.27 %
% of genes from short scaffolds (< 2000 bps) 72.90 %
Associated GOLD sequencing projects 57
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(51.402 % of family members)
Environment Ontology (ENVO) Unclassified
(96.262 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(85.047 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 32.56%    β-sheet: 0.00%    Coil/Unstructured: 67.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF08281Sigma70_r4_2 34.58
PF00263Secretin 17.76
PF01546Peptidase_M20 6.54
PF03065Glyco_hydro_57 1.87
PF01850PIN 1.87
PF00664ABC_membrane 0.93
PF04480DUF559 0.93
PF09095AmyA-gluTrfs_C 0.93
PF03551PadR 0.93
PF07687M20_dimer 0.93
PF00571CBS 0.93
PF00136DNA_pol_B 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0417DNA polymerase B elongation subunitReplication, recombination and repair [L] 0.93
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.93
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.93
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009518|Ga0116128_1083860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2958Open in IMG/M
3300009518|Ga0116128_1090911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2910Open in IMG/M
3300009519|Ga0116108_1016484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22610Open in IMG/M
3300009547|Ga0116136_1030390All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300009548|Ga0116107_1020649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2592Open in IMG/M
3300009548|Ga0116107_1048117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21465Open in IMG/M
3300009549|Ga0116137_1023613All Organisms → cellular organisms → Bacteria2246Open in IMG/M
3300009549|Ga0116137_1050623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21351Open in IMG/M
3300009615|Ga0116103_1063820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21004Open in IMG/M
3300009616|Ga0116111_1019523All Organisms → cellular organisms → Bacteria2411Open in IMG/M
3300009616|Ga0116111_1107649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2697Open in IMG/M
3300009618|Ga0116127_1016882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2430Open in IMG/M
3300009618|Ga0116127_1110906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2712Open in IMG/M
3300009631|Ga0116115_1096776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2758Open in IMG/M
3300009640|Ga0116126_1031665All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300009646|Ga0116132_1143738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2727Open in IMG/M
3300009760|Ga0116131_1019951All Organisms → cellular organisms → Bacteria2447Open in IMG/M
3300009760|Ga0116131_1105564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2840Open in IMG/M
3300009760|Ga0116131_1128638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2740Open in IMG/M
3300014151|Ga0181539_1038248All Organisms → cellular organisms → Bacteria2378Open in IMG/M
3300014151|Ga0181539_1268643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2633Open in IMG/M
3300014152|Ga0181533_1050329All Organisms → cellular organisms → Bacteria2158Open in IMG/M
3300014152|Ga0181533_1180026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2834Open in IMG/M
3300014155|Ga0181524_10160881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21148Open in IMG/M
3300014156|Ga0181518_10431309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2632Open in IMG/M
3300014159|Ga0181530_10088971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21875Open in IMG/M
3300014491|Ga0182014_10036831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3622Open in IMG/M
3300014498|Ga0182019_10913053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2634Open in IMG/M
3300014638|Ga0181536_10035783All Organisms → cellular organisms → Bacteria3548Open in IMG/M
3300017925|Ga0187856_1000895All Organisms → cellular organisms → Bacteria25181Open in IMG/M
3300017925|Ga0187856_1034195All Organisms → cellular organisms → Bacteria2378Open in IMG/M
3300017925|Ga0187856_1107563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21100Open in IMG/M
3300017929|Ga0187849_1021747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3574Open in IMG/M
3300017929|Ga0187849_1042004All Organisms → cellular organisms → Bacteria2216Open in IMG/M
3300017929|Ga0187849_1051306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1927Open in IMG/M
3300017929|Ga0187849_1117551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21106Open in IMG/M
3300017929|Ga0187849_1150736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2938Open in IMG/M
3300017929|Ga0187849_1190908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2804Open in IMG/M
3300017931|Ga0187877_1027643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2894Open in IMG/M
3300017931|Ga0187877_1064454All Organisms → cellular organisms → Bacteria → Acidobacteria1618Open in IMG/M
3300017931|Ga0187877_1116891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21098Open in IMG/M
3300017931|Ga0187877_1210210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2760Open in IMG/M
3300017935|Ga0187848_10083711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21474Open in IMG/M
3300017938|Ga0187854_10021659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3574Open in IMG/M
3300017938|Ga0187854_10110399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1280Open in IMG/M
3300017938|Ga0187854_10136230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21123Open in IMG/M
3300017940|Ga0187853_10054971All Organisms → cellular organisms → Bacteria → Acidobacteria2031Open in IMG/M
3300017940|Ga0187853_10169958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21034Open in IMG/M
3300017941|Ga0187850_10075540All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300017941|Ga0187850_10386290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2612Open in IMG/M
3300017996|Ga0187891_1076898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21315Open in IMG/M
3300017998|Ga0187870_1060970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1571Open in IMG/M
3300018002|Ga0187868_1019908All Organisms → cellular organisms → Bacteria3253Open in IMG/M
3300018002|Ga0187868_1032368All Organisms → cellular organisms → Bacteria2378Open in IMG/M
3300018002|Ga0187868_1278138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2557Open in IMG/M
3300018004|Ga0187865_1037087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22061Open in IMG/M
3300018004|Ga0187865_1091327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21131Open in IMG/M
3300018004|Ga0187865_1147194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2828Open in IMG/M
3300018004|Ga0187865_1236162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2614Open in IMG/M
3300018005|Ga0187878_1267065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2619Open in IMG/M
3300018008|Ga0187888_1124824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21074Open in IMG/M
3300018008|Ga0187888_1127730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21058Open in IMG/M
3300018009|Ga0187884_10054371All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300018009|Ga0187884_10158514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2950Open in IMG/M
3300018013|Ga0187873_1024906All Organisms → cellular organisms → Bacteria → Acidobacteria2961Open in IMG/M
3300018014|Ga0187860_1227839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2750Open in IMG/M
3300018014|Ga0187860_1354086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2558Open in IMG/M
3300018015|Ga0187866_1082734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21363Open in IMG/M
3300018015|Ga0187866_1119893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21059Open in IMG/M
3300018015|Ga0187866_1185834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2781Open in IMG/M
3300018016|Ga0187880_1219127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2854Open in IMG/M
3300018018|Ga0187886_1125129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21044Open in IMG/M
3300018019|Ga0187874_10028462All Organisms → cellular organisms → Bacteria → Acidobacteria2799Open in IMG/M
3300018019|Ga0187874_10243245All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2740Open in IMG/M
3300018020|Ga0187861_10166107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21007Open in IMG/M
3300018021|Ga0187882_1192534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2807Open in IMG/M
3300018023|Ga0187889_10332318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2667Open in IMG/M
3300018023|Ga0187889_10381070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2613Open in IMG/M
3300018024|Ga0187881_10116611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21191Open in IMG/M
3300018024|Ga0187881_10128075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21123Open in IMG/M
3300018025|Ga0187885_10129652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21206Open in IMG/M
3300018026|Ga0187857_10061092All Organisms → cellular organisms → Bacteria → Acidobacteria1901Open in IMG/M
3300018026|Ga0187857_10570227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2505Open in IMG/M
3300018030|Ga0187869_10179511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21042Open in IMG/M
3300018088|Ga0187771_10761715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2821Open in IMG/M
3300019788|Ga0182028_1268467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2644Open in IMG/M
3300023088|Ga0224555_1001999All Organisms → cellular organisms → Bacteria → Acidobacteria25413Open in IMG/M
3300023232|Ga0224516_1023283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2826Open in IMG/M
3300025432|Ga0208821_1021715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21392Open in IMG/M
3300025441|Ga0208456_1035277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21007Open in IMG/M
3300025442|Ga0208034_1013347All Organisms → cellular organisms → Bacteria → Acidobacteria2589Open in IMG/M
3300025442|Ga0208034_1036285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21132Open in IMG/M
3300025446|Ga0208038_1022458All Organisms → cellular organisms → Bacteria → Acidobacteria1491Open in IMG/M
3300025469|Ga0208687_1065114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2845Open in IMG/M
3300025480|Ga0208688_1028817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21345Open in IMG/M
3300025498|Ga0208819_1020791All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300025812|Ga0208457_1055935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2808Open in IMG/M
3300032069|Ga0315282_10136482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21991Open in IMG/M
3300033402|Ga0326728_10005429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia35795Open in IMG/M
3300033402|Ga0326728_10008043All Organisms → cellular organisms → Bacteria26546Open in IMG/M
3300033402|Ga0326728_10032509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8678Open in IMG/M
3300033402|Ga0326728_10088338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3880Open in IMG/M
3300033402|Ga0326728_10308094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21437Open in IMG/M
3300033402|Ga0326728_10524367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2953Open in IMG/M
3300033402|Ga0326728_10835626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2664Open in IMG/M
3300033405|Ga0326727_10802073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2726Open in IMG/M
3300033977|Ga0314861_0503740Not Available519Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland51.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland26.17%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.48%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil7.48%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.87%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023232Peat soil microbial communities from Stordalen Mire, Sweden - IR.F.S.T0EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0116128_108386023300009518PeatlandMHDDEPNPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSVGSLEIPRIIVAALQIEPLDDSQPEKGK*
Ga0116128_109091123300009518PeatlandMHDDEPDPFVNELLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK*
Ga0116108_101648423300009519PeatlandMHDDEPDPFVNELIEASLKQYRGEEPRSGLEMRILAGIRTRERAARRRGLGWAVAVCAGILAVIALTLHFAPTRLRQPTPSASLPQPVTTPPAPQMVSQQAPWLGGRRPPAQFRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKATKPDLVAGTDETDEAPISDLEIPRIKIAALEIKPLDDSQSEQEK*
Ga0116136_103039013300009547PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGG
Ga0116107_102064933300009548PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK*
Ga0116107_104811723300009548PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK*
Ga0116137_102361343300009549PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK*
Ga0116137_105062323300009549PeatlandMHDDEPDPYVDELLEASLKQYRGEEPRSGLEMRILAAVRTQERAARLRWLGWAVAVCAGILVAIALTLHFARAPHRQLTPSAELSPKESGARRAPLQTAKPPAPAMASQQRALSGPPRPVAGVRRVATRRSRPEQFPSPLPLTEQEKLLLAFLEKATEPDLVAGTNETDVAPVSDLEISRIKIAALEIKPLDDSQSEQEK*
Ga0116103_106382013300009615PeatlandELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK*
Ga0116111_101952333300009616PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQGK*
Ga0116111_110764923300009616PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERATRLHWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTQPAPPMVSRQQRLLSLRRPAGGVHRVATRRSPPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSEQGK*
Ga0116127_101688223300009618PeatlandMHDDEPDPFVNELLEASLKQYRGKEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK*
Ga0116127_111090623300009618PeatlandMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK*
Ga0116115_109677613300009631PeatlandDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK*
Ga0116126_103166543300009640PeatlandMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRAQVRAARLRWLGWSVAVCAGVLAVIALTLHFARAPLRQPTASALLPQPATLQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSISGIDENTAGGLEIPRIIVDALQIEPLDDSQSEQGK*
Ga0116132_114373823300009646PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLL
Ga0116131_101995143300009760PeatlandDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTQPAPPMVSRQQRLLSLRRPAGGVHRVATRRSPPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSEQGK*
Ga0116131_110556423300009760PeatlandMYDDEPDPFVNKLLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK*
Ga0116131_112863823300009760PeatlandSLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK
Ga0181539_103824823300014151BogMHDDEPDPFVNESLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK*
Ga0181539_126864313300014151BogEEPRSGLEMRILAGVRTQERAARLRWLGWAAAVCAGILAVIALTLHFARAPLRQPTPSASLPQAATTQPAPPMVSRQQPLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALKIEPLDDSQSEQGK*
Ga0181533_105032953300014152BogMHDDEPDPFVNELLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPAGGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQ
Ga0181533_118002623300014152BogMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGVLAVIAVTLHFARAPLRQPTASASLPQPATMQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGL
Ga0181524_1016088113300014155BogKQYRGEEPRSGHEMRILAGVRAQVRAARLRWLGWSVAVCAGVLAVIALTLHFARAPLRQPTASALLPQPATLQPTPRTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLASLNKATKPDLIAGTNETDEAPVSDLEIPRIKIVGLEIKPLDDFQPEQEK*
Ga0181518_1043130913300014156BogMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRAQVRAARLRWLGWSVAVCAGVLAVIALTLHFARAPLRQPTASALLPQPATLQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSISGIDENTAGGLEIPRIIVAAL
Ga0181530_1008897133300014159BogMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRAQVRAARLRWLGWSVAVCAGVLAVIALTLHFARAPLRQPTASALLPQPATLQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSISGIDENTAGGLEIPRIIVAALQIEPLDDSQSEQGK*
Ga0182014_1003683123300014491BogMHDDKPDPFVDDLLETSLKRYHGKEPRSGLEMRILAAIRSRERAARRRWLGWAAAACAGILAIIVLTLHFAPAPHRQLTPSAELSPKESGAQRAPLQAAKPSTPAMASQQQLRLGSRGPAARVHRVATRQPRPEQFPTPSPLTEQERLLLAYLNKATQPDSTSGTDAKAINDLEVPEINVAALKIEPLEDSQSEQGK*
Ga0182019_1091305313300014498FenMHDDKPDPFVDDLLETSLKRYHGKEPRSGLEMRILAAIRSRERAARRRWLGWAAAACAGILAIIVLTLHFAPAPHRQLTPSAELSPKESGAQRAPLQAAKPSTPAMASQQQLRLGSRGPAARVHRVATRQPRPEQFPTPSPLTEQERLLLAYLNKATQPDSTSGTDAKAINDLEVPEINVAALK
Ga0181536_1003578323300014638BogMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQVK*
Ga0187856_100089553300017925PeatlandMHDDEPNPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSVGSLEIPRIIVAALQIEPLDDSQPEKGK
Ga0187856_103419523300017925PeatlandMHDDEPDPFVNELLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK
Ga0187856_110756323300017925PeatlandMHDDEPDPFVNELLEASLKQYRGEEPRAGLEMRILAGVRTQERAARLRWLGWAVAVCTGVLAVIALTLHFARAPQRQPTASALLPQAATTQPAPPMVSRQQPLLSPRRLASGVRRVATLRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK
Ga0187849_102174733300017929PeatlandMHDDEPDPFVNELIEASLKQYRGEEPRSGLEMRILAGIRTRERAARRRGLGWAVAVCAGILAVIALTLHFAPTRLRQPTPSASLPQPVTTPPAPQMVSQQAPWLGGRRPPAQFRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKATKPDLVAGTDETDEAPISDLEIPRIKIAALEIKPLDDSQSEQEK
Ga0187849_104200443300017929PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0187849_105130623300017929PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERATRLHWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTQPAPPMVSRQQRLLSPRRPAGGVHRVATRRSPPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187849_111755123300017929PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVA
Ga0187849_115073623300017929PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187849_119090813300017929PeatlandSRPCWSINMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDEKPVNDLEVPEITVAALKIKPLEDSQSDQEK
Ga0187877_102764343300017931PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERATRLHWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTQPAPPMVSRQQRLLSLRRPAGGVHRVATRRSPPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187877_106445413300017931PeatlandEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK
Ga0187877_111689123300017931PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRI
Ga0187877_121021013300017931PeatlandINMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187848_1008371133300017935PeatlandMYDDEPDPFVNKLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAAAVCAGILAVIALTLHFARAPLRQPTPSASLPQAATTQPAPPMVSRQQPLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALKIEPLDDSQSEQGK
Ga0187854_1002165933300017938PeatlandMHDDEPDPFVNELIEASLKQYRGEEPRSGLEMRILAGIRTRERAARRRGLGWAVAVCAGILAVIALTLHFAPTRLRQPTPSASLPQPVTTPPAPQMVSQQAPWLGGRRPPAQFRRVATRRSLPEQFPTPLPLTEQEKLLLAYLDKATKPDLVAGTDETDEAPISDLEIPRIKIAALEIKPLDDSQSEQEK
Ga0187854_1011039933300017938PeatlandLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPQPATTQPAPPTVSRQQPLLSPRRPGVGVRRVAKRGSRPEQFPTPLPLTEQEKLLLAYLDKATKPDLIAGTDEKPVNDLEVPEITVAALKIKPLEDSQSDQEK
Ga0187854_1013623023300017938PeatlandMHDDEPDPFVDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187853_1005497113300017940PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK
Ga0187853_1016995813300017940PeatlandHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0187850_1007554043300017941PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRI
Ga0187850_1038629013300017941PeatlandKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFAPTHLRQPTPSASLPQPATTQPAPPTVSRQQPLLSPRRPASGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDNATRPDLAEGTKQTDEAPFRDLEIPRIIVAALQIEPLDGSQSEQGK
Ga0187891_107689833300017996PeatlandMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAAAVCAGILAVIALTLHFARAPLRQPTPSASLPQAATTQPAPPMVSRQQPLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALKIEPLDDSQSEQGK
Ga0187870_106097013300017998PeatlandRRQKSSRRRKSHRCWESRKVQSGPDCCGHAKSCARNSRPCWSINMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDEKPVNDLEVPEITVAALKIKPLEDSQSDQEK
Ga0187868_101990843300018002PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK
Ga0187868_103236823300018002PeatlandMHDDEPDPFVNELLEASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPTVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK
Ga0187868_127813823300018002PeatlandMYDDEPDPFVNKLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAAAVCAGILAVIALTLHFARAPLRQPTPSASLPQAATTQPAPPMVSRQQPLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGL
Ga0187865_103708723300018004PeatlandMHDDEPDPYVDELLEASLKQYRGEEPRSGLEMRILAAVRTQERAARLRWLGWAVAVCAGILVAIALTLHFARAPHRQLTPSAELSPKESGARRAPLQAAKPPAPAMASQQRALSGPPRPVAGVRRVATRRSRPEQFPSPLPLTEQEKLLLAFLEKATEPDLVAGTNETDVAPVSDLEISRIKIAALEIKPLDDSQSEQEK
Ga0187865_109132713300018004PeatlandVLGIPEGSVRTRLLRAREILPRNSRPCWSINMHDDEPDPFLDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAVRHRWLGWAVAVCAGILAVIALTLHFASSQLRQPTPSASLPQPATTQPAPPMVSRQHPLLSPRRPEARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187865_114719413300018004PeatlandSRPCWSINMHDDEPDPFLDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK
Ga0187865_123616213300018004PeatlandSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSVGSLEIPRIIVAALQIEPLDDSQPEKGK
Ga0187878_126706523300018005PeatlandLAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187888_112482423300018008PeatlandMHDDEPNPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSV
Ga0187888_112773023300018008PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTANPDSIPGTDENTAGGLEIPRIIVAALQIEPLDDSQSEQ
Ga0187884_1005437113300018009PeatlandMHDDEPDPFVDELLEASLRHYRGEEPRSGLEMRILAGVRTQERATRLHWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTQPAPPMVSRQQRLLSPRRPAGGVHRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187884_1015851413300018009PeatlandMHDDKRDQFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGVLAVIAVTLHFARAPLRQPTASASLPQPATMQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLASLNKATKPDLIAGTNETDEAPVSDLEIPRIKIVGLEIKPLDDFQPEQEK
Ga0187873_102490623300018013PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQESAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187860_122783913300018014PeatlandMHDDEPNPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENS
Ga0187860_135408613300018014PeatlandEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGVLAVIAVTLHFARAPLRQPTASASLPQPATMQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLASLNKATKPDLIAGTNETDEAPVSDLEIPRIKIVGLEIKPLDDFQPEQEK
Ga0187866_108273423300018015PeatlandMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDEKPVNDLEVPEITVAALKIKPLEDSQSDQEK
Ga0187866_111989313300018015PeatlandRACWSINMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0187866_118583413300018015PeatlandMRILAGVRTQERAARLRWLGWTAAVCAGILAVVALTLHFARAPLRQPTPSASLPQPATTHPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0187880_121912723300018016PeatlandEASLKQYRGEEPRSGLEMRILAGVRAQVRAARLRWLGWSVAVCAGVLAVIALTLHFARAPLRQPTASALLPQPATLQPTPTTVSRQQPLHSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLASLNKATKPDLIAGTNETDEAPVSDLEIPRIKIVGLEIKPLDDFQPEQEK
Ga0187886_112512923300018018PeatlandASLKQYRGEEPRSGLEMRILAGVRTQEGAARLRWLGWAVAVCAGILAVIALTLHFARAPVRQPTPSASLPQPATTQPALPMVSRQQLLLSPRRPADGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTGENSAGGLEIPRIIVAALQIEPLDDSQSKQGK
Ga0187874_1002846233300018019PeatlandMHDDEPDPFVNELLEASLKQYRGKEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK
Ga0187874_1024324513300018019PeatlandMHDDEPDPFVNELLEASLKQYRGEEPRAGLEMRILAGVRTQERAARLRWLGWAVAVCTGVLAVIALTLHFARAPQRQPTASALLPQAATTQPAPPMVSRQQPLLSPRRLASGVRRVATLRSRPEQFPTPLPLTEQEKLLLAYFNKTANPDSIPGTDENTAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187861_1016610713300018020PeatlandDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0187882_119253413300018021PeatlandKSCARNSRPCWSINMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDEKPVNDLEVPEITVAALKIKPLEDSQSDQEK
Ga0187889_1033231813300018023PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKLSTPALASQQQLRLGSREPAARVHRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK
Ga0187889_1038107013300018023PeatlandKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWTAAVCAGILAVIALTLHFARAPLRQPTPSASLPQPATTHPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPETAK
Ga0187881_1011661123300018024PeatlandMRILAGVRTQERAVRHRWLGWAVAVCAGILAVIALTLHFASSQLRQPTPSASLPQPATTQPAPPMVSRQHPLLSPRRPEARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQGK
Ga0187881_1012807523300018024PeatlandMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDEKPVNDLEVPEITVAALKIKPLEDSQSEQEK
Ga0187885_1012965213300018025PeatlandMHDDEPDPYVDELLEASLKQYRGEEPRSGLEMRILAAVRTQERAARLRWLGWAVAVCAGILVAIALTLHFARAPHRQLTPSAELSPKESGARRAPLQAAKPPAPAMASQQRALSGPPRPVAGVRRVATRRSRPEQFPSPLPLTEQEKLLLAFLEKATEPDLVAGTNETDVAPVSDLEISRIKIAALEIKPLDDSQS
Ga0187857_1006109233300018026PeatlandGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQEK
Ga0187857_1057022713300018026PeatlandMHDDEPDPFVDELLEASLKEFQGEEPRSGLEMRILAGVRTQERATRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPTPSASLPQPATTPPAPQRVSQQAPRLGTRRPPAQSRRVATRRSRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAGTDE
Ga0187869_1017951113300018030PeatlandINMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0187771_1076171513300018088Tropical PeatlandMQDEKRDQFVDDLLDASLKQYRGEEPRPGLEMRILGGIRTQERAARLRWLGWAVAACAGILAAIVLTLHSVRTPLRQPTFSAALPPKESGAQRAPLQAAKPPAAVVASEQRPPSLGAHRAPLQPPQQRVGRAAAPRSRPEQFPT
Ga0182028_126846713300019788FenSTVGWSINMHDDKPDPFVDDLLETSLKRYHGKEPRSGLEMRILAAIRSRERAARRRWLGWAAAACAGILAIIVLTLHFAPAPHRQLTPSAELSPKESGAQRAPLQAAKPSTPAMASQQQLRLGSRGPAARVHRVATRQPRPEQFPTPSPLTEQERLLLAYLNKATQPDSTSGTDAKAINDLEVPEINVAALKIEPLEDSQSEQGK
Ga0224555_1001999253300023088SoilMHDDKPDPFVDDLLETSLKRYHGKEPRSGLEMRILAAIRSRERAARRRWLGWAAAACAGILAIIVLTLHFAPAPHRQLTPSAELSPKESGAQRAPLQAAKPSTPAMASQQQLRLGSRGPAARVHRVATRQPRPEQFPTPSPLTEQERLLLAYLNKATQPDSTSGTDAKAINDLEVPEINVAALKIEPLEDSQSEQGK
Ga0224516_102328323300023232SoilGLEMRILAAIRSRERAARRRWLGWAAAACAGILAIIVLTLHFAPAPHRQLTPSAELSPKESGAQRAPLQAAKPSTPAMASQQQLRLGSRGPAARVHRVATRQPRPEQFPTPSPLTEQERLLLAYLNKATQPDSTSGTDAKAINDLEVPEINVAALKIEPLEDSQSEQGK
Ga0208821_102171513300025432PeatlandRRRKSHRRWESPRVRSGPDCCGHAQSCARNWRACWSINMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0208456_103527713300025441PeatlandELLEASLKQYRGEEPRSGLEMRILTGVRTQERAARFRWLGWAVAVCAGILAVIALALHFTRAPLRQPTPSASLPQPATTQPAPPMVSRQQRQLSPRRPAREVRRVATRRSRPEQFPTPLPITEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRIIVAALQIEPLDDSQSEQEK
Ga0208034_101334713300025442PeatlandMHDDEPNPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSVGSL
Ga0208034_103628513300025442PeatlandMHDDEPDPFLDDLLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQ
Ga0208038_102245813300025446PeatlandQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAAIALTLHFARAPHRQLTPSAELSPKESGAQRAPLQAAKPPAPAMASQQRALSGPRRPVARVRRVATRRSRPEQFPTPLPLTEQEKLLLAYLDKAPKPDLIAGTNETDVAPVSDLEIPRIKIAALEIKPLDDSQPEQE
Ga0208687_106511423300025469PeatlandKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQPTPSASLPSKESGAHRALLQPPLAQQLSPSFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSAGGLEIPRITVAALQIEPLDDSQSKQGK
Ga0208688_102881723300025480PeatlandMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEM
Ga0208819_102079113300025498PeatlandEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGIVAVIALTLHFAPPQLRQPTPSASLPQPTATQPASPMVSRQRLLLSPRRPAREVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENSVGSLEIPRIIVAALQIEPLDDSQPEKGK
Ga0208457_105593513300025812PeatlandRAESCARNSRPCWSINMHDDEPDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGILAVIALTLHFARAPLRQSTPRASLPQPVTTPPAPPTVSRQQPLLTPRRPGVGVRRAATRRSRPEQFPTPLPLTQQEKLLLAYFNKAAPAGSVPGAYGNTPDGLEIPRIKIAALEIEPLDDSQPEMAK
Ga0315282_1013648223300032069SedimentMHDDERDPFVDELLEASLKQYRGEEPRSGLEMRILAGVRTQERAARLRWLGWALAVCAGILAVIALTLHFARAPLRQPTPSASLPQPATTQPAPPMVSRQQPLLSPRRPAGGVRRVATRRSRPEQFPTPLPLTEQEKLLLAYFNKTAKPDSIPGTDENTAGGLEIPRIIVAALQIKPLDDSQSEQGK
Ga0326728_10005429173300033402Peat SoilMHDDKPAPFVDELLEASLKQYRGEEPRSGLEMRILAGIRNRQRAARRRGLGWAVAACAGTLAIIVLTLHFARAPLRQPTPRAALPQPVTTQPAPPMVSREQLRLGPRKPPGGVRRVATRRSRPEQFPTPLPLTEQEKLLLAFLNKATKPDLVAGTNETEEAPVSDLEISRIKIAALEIKPLDDSQFEQGK
Ga0326728_10008043233300033402Peat SoilMHDDEPDPFVDELLEASLRQYRGEEPRSGLEMRILGGVRTQERAVRLRWLGWAVAVCAGILAVIALTLHFAPTQLRQPIPRASLPQPAKTQTAPPMDSRQQPLLSPHRPASKVHRVAMRPEQFPTPLPLTEQEKLLLAYLNKATKPDLTAATDEKPVNDLEVPEITVAALKTKPLEDSQSDQEK
Ga0326728_1003250953300033402Peat SoilMHDDEPDPFVDELLEASLKQYRDEEPRSGLEMRILAGVRTQERAVRLRWLGWTVAVCAGILAVIALTLHFAPTQLRQPTPGASLPQPAKTQTAPPMASRQQPLLSPHRPASKVHRVAMRPEQFPTPLPLTEQEKLLLAYLNKATKPDLVAGTNQTDEASFSDLEIPRIKIAGLEIKPLDDSQSEQEK
Ga0326728_1008833843300033402Peat SoilMHDDKRDQFVDELLEALLKQYRGEGPPSGLEMRILARVRTQERAARLRWLGWAVAVCAGTLAVIALTLHVAPTRLRQPTSSVSLPQSATTQPAPPMVSRERRLESPRRPARGVRRVATLRSRPEQFPTPSPLTEQEKLLLAYFNKTAKPDSIPGTDENTAGGLEIPRITVAALQIEPLDDSQSEQGK
Ga0326728_1030809423300033402Peat SoilMHDDKPDRFVDDLLEASLRQYCGEEPRPGLEMRVLAGIRTQERAARRRWLGWAAAVCTGMMAIIVLTLHFARAPVRQPAPRVSLPPKESGAQRSLLQPPLAQQPPPSFGAHRAPLQPPQQQVRRVARRHSRPEQFPTPLPLTEQERLLLAYVSKAGKAGLAEGANATDQAPITELAISAIKIAPLEIKPLDDSQLEQGK
Ga0326728_1052436713300033402Peat SoilMHDDEPDPFVDELLEASLKRYRDGEPRSGLEMRILAEIRTRERAARFRWLGWAVAVCAGILAVSALTLHFAPAPLRHPTPSAALPQPATTQPAAAMVSQQRPLSGARGPVPRVRRVATRWSRPEQFPTPLPLTEQEKLLLAYFNKAAKADSIPGADENAPDGLEIPRIKIAALEIKPLDDSQSEQEK
Ga0326728_1083562623300033402Peat SoilMHDDKRDQFVDELLEAALKRYRGEEPRSGLEMRILAGVRTQERAARLRWLGWAVAVCAGVLAAIVLTLHFARAPLRQPTPSAALPPKESGAQRAPLQQPLAQQLSPRFGAHRAPLQPPQQRVRRVATRRSRPEQFPTPLPLTEQERLLLAFVN
Ga0326727_1080207323300033405Peat SoilALLKQYRGEGPPSGLEMRILARVRTQERAARLRWLGWAVAVCAGTLAVIALTLHVAPTRLRQPTSSVSLPQSATTQPAPPMVSRERRLESPRRPARGVRRVATLRSRPEQFPTPSPLTEQEKLLLAYFNKTAKPDSIPGTDENTAGGLEIPRITVAALQIEPLDDSQSEQGK
Ga0314861_0503740_3_5183300033977PeatlandSGLEMRILAGVRTRERAARRRWLGWGVTVCAGILAIIALTLHFVRAPRRQPAPRASLSPKESGTHRAPLQAARPPAPTVVAQQAQASLSAHRAPLQPPQRGVRMVASPHSRPEQFPTPLPLTEREKLLLAYLSKPAKPDSIVGTSEKADAPISDLEVPGIKIAALEIKPLDA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.