NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091198

Metagenome / Metatranscriptome Family F091198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091198
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 103 residues
Representative Sequence MISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALG
Number of Associated Samples 75
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.74 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 86.92 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.131 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(39.252 % of family members)
Environment Ontology (ENVO) Unclassified
(95.327 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(75.701 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 17.83%    β-sheet: 0.00%    Coil/Unstructured: 82.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF17189Glyco_hydro_30C 7.48
PF00248Aldo_ket_red 5.61
PF00581Rhodanese 0.93
PF08544GHMP_kinases_C 0.93
PF03683UPF0175 0.93
PF07676PD40 0.93
PF00069Pkinase 0.93
PF02770Acyl-CoA_dh_M 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.74
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.93
COG2886Predicted antitoxin, contains HTH domainGeneral function prediction only [R] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.13 %
UnclassifiedrootN/A1.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009518|Ga0116128_1057459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21213Open in IMG/M
3300009518|Ga0116128_1094506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2888Open in IMG/M
3300009519|Ga0116108_1103835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300009615|Ga0116103_1092198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2783Open in IMG/M
3300009615|Ga0116103_1139385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2593Open in IMG/M
3300009616|Ga0116111_1025331All Organisms → cellular organisms → Bacteria → Acidobacteria1990Open in IMG/M
3300009616|Ga0116111_1082749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2842Open in IMG/M
3300009616|Ga0116111_1114593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2667Open in IMG/M
3300009617|Ga0116123_1079318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2893Open in IMG/M
3300009618|Ga0116127_1078477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2895Open in IMG/M
3300009637|Ga0116118_1221589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2587Open in IMG/M
3300009640|Ga0116126_1150753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2781Open in IMG/M
3300009641|Ga0116120_1281402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2518Open in IMG/M
3300009643|Ga0116110_1200041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2648Open in IMG/M
3300009643|Ga0116110_1244823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2575Open in IMG/M
3300009646|Ga0116132_1092394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2934Open in IMG/M
3300009760|Ga0116131_1085301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2963Open in IMG/M
3300009760|Ga0116131_1123983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2758Open in IMG/M
3300010339|Ga0074046_10064292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22408Open in IMG/M
3300010341|Ga0074045_10498345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2783Open in IMG/M
3300010343|Ga0074044_10355213All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300010379|Ga0136449_103794337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2569Open in IMG/M
3300014151|Ga0181539_1349852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2534Open in IMG/M
3300014152|Ga0181533_1028052All Organisms → cellular organisms → Bacteria3346Open in IMG/M
3300014159|Ga0181530_10357566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2752Open in IMG/M
3300014162|Ga0181538_10162903All Organisms → cellular organisms → Bacteria → Acidobacteria1272Open in IMG/M
3300014494|Ga0182017_10890482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2536Open in IMG/M
3300014638|Ga0181536_10400424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2614Open in IMG/M
3300017925|Ga0187856_1095322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21193Open in IMG/M
3300017929|Ga0187849_1314129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2584Open in IMG/M
3300017931|Ga0187877_1174043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2854Open in IMG/M
3300017938|Ga0187854_10023966All Organisms → cellular organisms → Bacteria3345Open in IMG/M
3300017940|Ga0187853_10504500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300017972|Ga0187781_10189496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21450Open in IMG/M
3300017972|Ga0187781_11038987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2600Open in IMG/M
3300017972|Ga0187781_11286867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2539Open in IMG/M
3300017973|Ga0187780_11241859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2547Open in IMG/M
3300017996|Ga0187891_1282542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300017998|Ga0187870_1154353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2837Open in IMG/M
3300017998|Ga0187870_1259631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2593Open in IMG/M
3300017998|Ga0187870_1334508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2502Open in IMG/M
3300018003|Ga0187876_1096644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21103Open in IMG/M
3300018004|Ga0187865_1050349All Organisms → cellular organisms → Bacteria → Acidobacteria1675Open in IMG/M
3300018004|Ga0187865_1122811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2932Open in IMG/M
3300018004|Ga0187865_1166816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2764Open in IMG/M
3300018008|Ga0187888_1421015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2502Open in IMG/M
3300018013|Ga0187873_1091014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21222Open in IMG/M
3300018014|Ga0187860_1015022All Organisms → cellular organisms → Bacteria4702Open in IMG/M
3300018014|Ga0187860_1023798All Organisms → cellular organisms → Bacteria3469Open in IMG/M
3300018014|Ga0187860_1285374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2644Open in IMG/M
3300018015|Ga0187866_1053531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1820Open in IMG/M
3300018015|Ga0187866_1057777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21732Open in IMG/M
3300018016|Ga0187880_1323947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2659Open in IMG/M
3300018017|Ga0187872_10293993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2713Open in IMG/M
3300018018|Ga0187886_1131849All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300018019|Ga0187874_10159288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2951Open in IMG/M
3300018019|Ga0187874_10178565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2888Open in IMG/M
3300018021|Ga0187882_1302212Not Available613Open in IMG/M
3300018022|Ga0187864_10194221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2967Open in IMG/M
3300018022|Ga0187864_10245670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2823Open in IMG/M
3300018022|Ga0187864_10311061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2700Open in IMG/M
3300018023|Ga0187889_10349193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2647Open in IMG/M
3300018023|Ga0187889_10440396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2560Open in IMG/M
3300018024|Ga0187881_10150126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21016Open in IMG/M
3300018024|Ga0187881_10433607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2537Open in IMG/M
3300018024|Ga0187881_10458033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300018024|Ga0187881_10473853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2510Open in IMG/M
3300018025|Ga0187885_10256023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2799Open in IMG/M
3300018025|Ga0187885_10322125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2698Open in IMG/M
3300018026|Ga0187857_10088283All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300018026|Ga0187857_10261872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2794Open in IMG/M
3300018030|Ga0187869_10069747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1816Open in IMG/M
3300018030|Ga0187869_10571330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2536Open in IMG/M
3300018057|Ga0187858_10703835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2603Open in IMG/M
3300018062|Ga0187784_10102418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22330Open in IMG/M
3300018062|Ga0187784_10244799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21459Open in IMG/M
3300018062|Ga0187784_10595523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2888Open in IMG/M
3300018062|Ga0187784_10645741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2849Open in IMG/M
3300018088|Ga0187771_10172302All Organisms → cellular organisms → Bacteria → Acidobacteria1788Open in IMG/M
3300018090|Ga0187770_10291586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21269Open in IMG/M
3300018090|Ga0187770_10599511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2876Open in IMG/M
3300018090|Ga0187770_11644753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2524Open in IMG/M
3300019211|Ga0187799_1054394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2545Open in IMG/M
3300019284|Ga0187797_1230985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2507Open in IMG/M
3300025432|Ga0208821_1005824All Organisms → cellular organisms → Bacteria3498Open in IMG/M
3300025441|Ga0208456_1070408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300025442|Ga0208034_1009537All Organisms → cellular organisms → Bacteria3372Open in IMG/M
3300025442|Ga0208034_1017050All Organisms → cellular organisms → Bacteria → Acidobacteria2120Open in IMG/M
3300025442|Ga0208034_1020559All Organisms → cellular organisms → Bacteria → Acidobacteria1810Open in IMG/M
3300025446|Ga0208038_1007725All Organisms → cellular organisms → Bacteria3482Open in IMG/M
3300025448|Ga0208037_1039388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2963Open in IMG/M
3300025459|Ga0208689_1047208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2908Open in IMG/M
3300025460|Ga0208562_1052712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2878Open in IMG/M
3300025469|Ga0208687_1016175All Organisms → cellular organisms → Bacteria → Acidobacteria2182Open in IMG/M
3300025477|Ga0208192_1062838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2713Open in IMG/M
3300025496|Ga0208191_1121587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2521Open in IMG/M
3300025498|Ga0208819_1025019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21576Open in IMG/M
3300025576|Ga0208820_1103150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2695Open in IMG/M
3300025812|Ga0208457_1015068All Organisms → cellular organisms → Bacteria2104Open in IMG/M
3300027854|Ga0209517_10393167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2781Open in IMG/M
3300033402|Ga0326728_10656099All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2800Open in IMG/M
3300033405|Ga0326727_10157979All Organisms → cellular organisms → Bacteria → Acidobacteria2644Open in IMG/M
3300033755|Ga0371489_0373817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2663Open in IMG/M
3300033977|Ga0314861_0190715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2975Open in IMG/M
3300033982|Ga0371487_0231189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2866Open in IMG/M
3300033983|Ga0371488_0254448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2858Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland39.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland31.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland11.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.67%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.67%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.80%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.80%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019211Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0116128_105745913300009518PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPPPADTSSQGQSKTGEKSGDNKDPAIQEQKSPKNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPIEYPYVG
Ga0116128_109450623300009518PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPIEFP
Ga0116108_110383523300009519PeatlandMISRTRWTPTFVLTAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGQKFKLVALGAFDPAQYPYVGVL
Ga0116137_114980323300009549PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTV
Ga0116103_109219823300009615PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAK
Ga0116103_113938513300009615PeatlandMISRNRWTPTFALGAMGIGALLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPIEYPYVGVLALIDQAENTDPSF
Ga0116111_102533113300009616PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTGQKFKLVALGAFDPFEYPYVGAIAAINQAEKSDPS
Ga0116111_108274923300009616PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKKIPPLTTGQ
Ga0116111_111459313300009616PeatlandMINRNWWAPTSVLAAMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIP
Ga0116123_107931823300009617PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALG
Ga0116127_107847723300009618PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPIE
Ga0116118_122158923300009637PeatlandMINRNWWAPTSVLAAMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNFLTVENAKNVPPLTTGQKFKLVALGTFDPIEY
Ga0116126_115075313300009640PeatlandMINRYLWAPSCVLGKILIPTLLLTSNFLAQQQSPASADTSSQGLSKAGEKSADNKDPAIQEQKSPKDDRIFWTLPNYLTVENGKRIPPLTTGQKFKLVALGAFDPVEYPYVGVIALINKFEKTD
Ga0116120_128140213300009641PeatlandMISRSWTPTSVLAAMVIGTLLLSFPLLAQQQNAASADTSSQGQSKTGEKSGDNKDPAIQEQKSPKNDRLFFVLPNYLTVEN
Ga0116110_120004113300009643PeatlandMISRSWTPTSILAAMVIGTFLLAFPMPAQQESPASADTPSQNPSKMGEKSGDKQDPPMQEQKSPSNDRVFYVVPNYLTVENAKEAPPLTTGQKFKLV
Ga0116110_124482313300009643PeatlandMINRYLWAPSCVLGTIVIPTLLLTSNFLAQQQSPAPADTSSQGQSKTGEKRGDDKDPATQEQKSPKDDRIFWTLPNYLTVENGKRIPPLTTGQKFKLVALGVFDPVEYPYVGVLALID
Ga0116132_109239423300009646PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTVQK
Ga0116131_108530113300009760PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPIEFPYVGVLALIDQAENDDPS
Ga0116131_112398323300009760PeatlandLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGQKFKLVALGAFDPAQYPYVGVLALINQAENDDPSYGQGFAGYAK
Ga0074046_1006429233300010339Bog Forest SoilMISRNRWTVTFALGAMVIGALLSAFPSLAQQQNPPPADTSSQGQSKTGAKSGDNKDPAIQEKKSPENDRLFWTLPNYLTVENGKQIPPLT
Ga0074045_1049834513300010341Bog Forest SoilMMSRTRWTPTFALDAVLIGTLLLAFPLLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQETSKKNDRLFWVVPNYLTVENAQNIPPLTTGQKFKLVALG
Ga0074044_1035521323300010343Bog Forest SoilMMSRTRWTPTFALDAVLIGTLLLAFPLLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQETSKKNDRLFWVVPNYLTVENAQNIPP
Ga0136449_10379433713300010379Peatlands SoilMIERNRRKPAFIVGAIGITIVLICVPLLAQQQSPAPADTSSPAPTKPGEKSGDNKDPAIQEQKSPTNDEKKPTNDRLFFLLPNYLTVENAKHIPPLTTGQKFKLEALGTFDPVEFPY
Ga0181539_134985213300014151BogMIKRKLRARAFLLRALVIGTLLLASPLVAQQQNPPSTDTISQCQSKAGEKSGENKDPSIQEQKSPTQEQSPKNDRLFFLLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPVEYPYVGVL
Ga0181533_102805243300014152BogMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTG
Ga0181530_1035756613300014159BogMISRSWTPTSILAAMVIGTFLLAFPMPAQQESPASADTPSQNPSKMGEKSGDKQDPPMQEQKSPSNDRVFYVVPNYLTVENAKEAPPLTTGQKFKLVALGAFDPFEY
Ga0181538_1016290313300014162BogMISRNRWAPTFVLVAMVIATLLWAFPLLAQQQNPASADTSSQGQSKKGEKSADNKDPSIQEQKSPKNDRLFYVLPNYLT
Ga0182017_1089048213300014494FenMVIGTLLLASPLVAQQQSPASADTSSQGQSKTGEKSADNKDPAIQEQKSPKNDRLFYVLPNYLTVENSKHIP
Ga0181536_1040042413300014638BogMISRNRWAPTFVLVAMVIATLLWAFPLLAQQQNPASADTSSQGQSKKGEKSADNKDPSIQEQKSPKNDRLFYVLPNYLTVE
Ga0187856_109532213300017925PeatlandMISRNRWAPTFVLVAMVIATLLWAFPLLAQQQNPASADTSSQGQSKKGEKSADNKDPSIQEQKSPKNDRLFYVLPNYLTVENSKHIPPLTTGQ
Ga0187849_131412913300017929PeatlandMISRNRWMVTFALGAMVIGTLLSAFPLLAQQQSPPPADTSSQGQPKTGAKSGDNKNPAIQEQKSPKNDRLFFALPNYLTVENGKQIPPLTTGQKFKLVA
Ga0187877_117404323300017931PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPVEYPYV
Ga0187854_1002396613300017938PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTG
Ga0187853_1050450023300017940PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQL
Ga0187781_1018949623300017972Tropical PeatlandMTSRTRRTPTFILTAIVIAPLLFSFPSLAQQQNPAPADSSSQAQSKPPEKSGDDKDPPVQEQKKPENDRIFWTLPNYLTVENAKQTPPLTTGQKFKLVALGTFD
Ga0187781_1103898723300017972Tropical PeatlandMVKRNLRARGVVLRAIVTATLPFVAFPLLAQQQNAPATDTTSQGQSKPDEKKSDSKDPAIEVQQSPKPEEKKPENDRLFFVLPNYLTVENAGKIPPLSTGQKFKLVALGTFDPIEFPYVGVLAGIDQAE
Ga0187781_1128686723300017972Tropical PeatlandMMFNRYRRMPRYVRGAALIATLLFAFPLLAQQQSPAPADTSSQGQSKAGEKSGENQDPAIQEQKRPENDRIFFALPNYLTVENAKQITPLTTGQKFKLVALGTFDPV
Ga0187780_1124185913300017973Tropical PeatlandMMSPTRWTPRIVLSALVIGTLLLPFPLLAQQQNPAPADTSSQGQSKPAEKSGSNDDPAIELQKKPENDRIFWALPNYLTVKDSKQIPPLTTGQKFKLVALGTFDPVEFPYVAVIAGIDQGEN
Ga0187891_128254223300017996PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTG
Ga0187870_115435323300017998PeatlandMVIGTLLLSFPLLAQQQNPASADTSSQGQSKTGEKGVDNKDPAIQEQKSPKNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPIE
Ga0187870_125963113300017998PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTT
Ga0187870_133450813300017998PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPPPADTSSQGQSKTGEKSGDNKDPAIQEQKSPKNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGT
Ga0187876_109664433300018003PeatlandMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPI
Ga0187865_105034933300018004PeatlandMISRNRWMVTFALGAMVIGTLLSAFPLLAQQQSPPPADTSSQGQPKTGAKSGDNKNPAIQEQKSPKNDRLFFALPNYLTVENGKQIPPLTTGQKF
Ga0187865_112281123300018004PeatlandMISRNRWTPTFALGAMGIGALLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPGMQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPIEYPYVGVL
Ga0187865_116681623300018004PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPVEYPYVGVLALIDQA
Ga0187888_142101523300018008PeatlandMINRNWWAPTSVLAAMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPP
Ga0187873_109101413300018013PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPVEYPYVGVLALIDQAEN
Ga0187860_101502213300018014PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGQKFKLVALGAFDPAQYPYVGVLALINQAENDDPSYGQGFAG
Ga0187860_102379843300018014PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGRKFKLVALGAFDPAQYPYVGVLALINQAENDDPSYGQGFAG
Ga0187860_128537413300018014PeatlandMINRYLWAPSCVLGKILIPTLLLTSNFLAQQQSPASADTSSQGLSKAGEKSADNKDPAIQEQKSPKDDRIFWTLPNYLTVENGKRIPPLTTGQKFKLVALGVFDPVEYPYVGVLALIDQAEN
Ga0187866_105353123300018015PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPL
Ga0187866_105777723300018015PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPIEFPYVGVLALIDQAENTDPSFG
Ga0187880_132394733300018016PeatlandMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPPL
Ga0187872_1029399313300018017PeatlandMISRNRWAPTFVLVAMVIATLLWAFPLLAQQQNPASADTSSQGQSKKGEKSADNKDPSIQEQKSPKNDRLFYVLPNYLTVEN
Ga0187886_113184913300018018PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEKKSPTNDRLFYVLPNFLT
Ga0187874_1015928823300018019PeatlandMISRNRWTVTFALGAMVIGTLLLAFPLLAQQQNPASADTASQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVAL
Ga0187874_1017856513300018019PeatlandMISRNRWTPTFALGAMGIGALLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPGMQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVAL
Ga0187882_130221213300018021PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTT
Ga0187864_1019422123300018022PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPIEFPYVGVLALIDQAENTDPSFR
Ga0187864_1024567013300018022PeatlandMISRSWTPTSILAAMVIGTFLLAFPMPAQQESPASADTPSQNPSKMGEKSGDKQDPPMQEQKSPSNDRVFYVVPNYLTVENAKEAPPLTTGQKYKLVALGAFDTLEYPNVGA
Ga0187864_1031106133300018022PeatlandMINRNWWAPTSVLAAMVIGTLLLAFPLPAQQQSPASADASSQNQSKAGEKSKDNKDPAIQEQKSPTNDRLFFVLPNFLTVENAKN
Ga0187889_1034919313300018023PeatlandMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALG
Ga0187889_1044039623300018023PeatlandMINRNWWAPTSVLAAMVIGTLLLAFPLPAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQ
Ga0187881_1015012613300018024PeatlandMISRNRWMVTFALGAMVIGTLLSAFPLLAQQQSPPPADTSSQGQPKTGAKSGDNKNPAIQEQKSPKNDRLFFALPNYLTVENGKQIPPLTTGQKFKLVARGA
Ga0187881_1043360713300018024PeatlandMIKRYLWAPSCVLGAIVIPTLLLTSQLLAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPKNDRLFFALPNYLTVENGKQIPPLTTGQKFKLVAL
Ga0187881_1045803323300018024PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSK
Ga0187881_1047385313300018024PeatlandMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPVEYPYVGVLALIDQAENDDPSYGQGF
Ga0187885_1025602323300018025PeatlandMVTFALGAMVIGTLLSAFPLLAQQQSPPPADTSSQGQPKTGAKSGDNKNPAIQEQKSPKNDRLFFALPNYLTVENGKQIPPLTTGQKFKLVA
Ga0187885_1032212523300018025PeatlandMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVA
Ga0187857_1008828313300018026PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGQKFK
Ga0187857_1026187213300018026PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKYDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALG
Ga0187869_1006974723300018030PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPP
Ga0187869_1057133013300018030PeatlandMISRSWTPTSVLAAMVIGTLLLSFPLLAQQQDPASADTSSQGQSKTGEKSGDNKDPAIQEQKSPKNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTFDPIEYPYVGALALIDQAENTDPTFRQGFA
Ga0187858_1070383513300018057PeatlandMISRNRWTPTFALGAMVIGVLLLALPLLAQQQNPASVDTSSQGQSKTGEKTGDNKDPAIQEQKNPKDDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPVEYPYVGV
Ga0187784_1010241833300018062Tropical PeatlandMIDRNRWARTFVLRAMVISTLWLAFPLLAQQQSPAAADTASQGQAKVEEKSGENKDPAIQVQKTPNQEEKKPENDRLFFLLPNYLTVENSKQIPPLTTGQKFKLVALGTFDPVEF
Ga0187784_1024479923300018062Tropical PeatlandMISLTRWAPRLVLSAIVIGTLLLPFPSRAQQQSPAPGDTTSQSQSKPTEKSGNNNDPGIEQQKKPENDRIFWALPNYLTVENPKQIPPLTTGQKFKLVALGTFDPVEFPYVGVIAAIDQAENDD
Ga0187784_1059552323300018062Tropical PeatlandMVISTLLFAFPLLAQQNPPPADTTTEGQTKPEEKSGENKDPAIQEQKSPTQEQSPKNDRLFFLLPNYLTVENAKKIPPLTTGQKFKLVALGTFD
Ga0187784_1064574123300018062Tropical PeatlandMIKRNWRALTCGLGAMAIGALLLAFPLRAQPQSPVSADTSPQGQSKAGAQSGNKQDPGIQEQKKPENDRIFWALPNYLTVENAKNIPPLTTGQKFKLVALGTF
Ga0187771_1017230213300018088Tropical PeatlandMISRNRWTVTFALGAMVIGTLLLAFPLLAQQQSPPPADTSSQGQSKPGAKSGDNNDPAIQEKKSPEDDRLFFVLPNY
Ga0187770_1029158613300018090Tropical PeatlandMIDRNRWARTFVLRAMVISTLWLAFPLLAQQQSPASADTTSQGQAQVGEKAGENKDPAIEVQKSPNQEQKKPENDRLFFLLPNYLTVEKANKIPPLTTGQKFKLVALGTFDP
Ga0187770_1059951123300018090Tropical PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSPAQQQNPPPADTASQDQSKTGAKSGDNKDPAIQEKKRPENDRLFFVLPNYLTVENAKNIPPLTTGQKIKLVALGTFDPI
Ga0187770_1164475313300018090Tropical PeatlandMIKRKLGARAYVLCGLAFCTLLSAFPLPAQEQNTSSADTSSQVQPKPVEKTKDKNDPPIQVQPNPKPEEKKPENDRLFFVLPNYLTVENANKIPPLTTGQKFKLVALGTFDPVEYPYVG
Ga0187799_105439413300019211PeatlandMISRTRWAPTFVLRAIVIVTLLLPFPFRAQQQNPASADTSSQGQPKTEPKSGDSADPPIQEQKKPENDRIFWTLPNYLTVENGKQIPPLTTGQKFKLVALGTFDPVEFPYVGVLALIDQAEN
Ga0187797_123098513300019284PeatlandMIKRNWLAPTFVLGAMLSVTLLLAFPLPAQQQSPAPVDTSSQSQSKAGEKSGEIKDPAIQVQTSPKNDRIFFALPNYLTVENAKHTPPLTTGQKFKLVALGTFDP
Ga0208821_100582443300025432PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGRKFKLVALGAFDPAQYPYVGILALINQAKNDDPSYGQGFA
Ga0208456_107040823300025441PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGR
Ga0208034_100953713300025442PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLT
Ga0208034_101705033300025442PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTGQKFKLVALGVFDPIEFPYVGVIAAIDQAEN
Ga0208034_102055933300025442PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPIEFPYVGVLALIDQAENTD
Ga0208038_100772543300025446PeatlandMINRTRWTPTFVLSAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKAGEKSGDNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGRKFKLVALGAFDPAQYPYVGILALINQAKNDDPSYGQGFAGYAK
Ga0208037_103938813300025448PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTGQKFKLVALGTFDP
Ga0208689_104720813300025459PeatlandMISRNRWTPTFALGAMGIGALLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPGMQEQKSPTNDRLFFVLPNYLTVENAKKIPPLTTGQKFKLVALGTF
Ga0208562_105271223300025460PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTGQKFKLVALGVFDP
Ga0208687_101617533300025469PeatlandMISRNRWTVTLARGAMVIGTLLLAFPLLAQQQNAASADTASQGQSKTGTKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENGKQIPPLTTGQKFKL
Ga0208192_106283813300025477PeatlandMISRNRWTPTFALGAMGIGALLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPGMQEQKSPTNDRLFFVLPNYLTVE
Ga0208191_112158713300025496PeatlandMINRYLWAPSCVLGKILIPTLLLTSNFLAQQQSPASADTSSQGLSKAGEKSADNKDPAIQEQKSPKDDRIFWTLPNYLTVENGKRIPPLTTGQKFKLVALGVFDPVEYPYVGVLALIDQAENDDPSYGQ
Ga0208819_102501923300025498PeatlandMISRNRWTVTFALGAMVIGTLLSAFPSLAQQQNPAPADTSSQGQSKTGAKSGDNKDPAIQEQKSPQNDRLFFVLPNYLTVENAKQIPPLTTG
Ga0208820_110315013300025576PeatlandMINRYLWAPSCVLGKILIPTLLLTSNFLAQQQSPASADTSSQGLSKAGEKSADNKDPAIQEQKSPKDDRIFWTLPNYLTVENGKRIPPLTTGQKFKLVALGV
Ga0208457_101506813300025812PeatlandMINRYLWAPSCVLSAIVICTLLLTSQFLAQQQNPAPADTSSQGQSKATEKSADNKDPAIQEQKSPKNDRLLFALPNYLTVENSKQLPPLTTGQKFKLVAL
Ga0209517_1039316713300027854Peatlands SoilMISRNRWVVTFALGAMVIGTLLSAFPLLAQQQNPPPADTSSQGQSKAAAKSEGKQDPAIQEKKSPEDDRLFFVLPNYLTVENGKQIPPLTTGQKFKLVANN
Ga0326728_1065609913300033402Peat SoilMINRTRWTPTFALDAMIIGTLLLAFPLLAQQQNPASADTSSQGQSKAGTKSGDNKDPAIQEQKSPTNDRLFFVLPNYLTVENAKNIPPLTTGQKFKLVALGTFDPIEFPYVG
Ga0326727_1015797933300033405Peat SoilMISRNRWTVTFALGAMVIGTLLLAFPLLAQQQNPASADTSSQGQSKTGAKSGDNKDPAIQEQKSPENDRLFFVLPNYLTVENAKNIPPLTTG
Ga0371489_0373817_2_3463300033755Peat SoilMISRSRWTVTFALGAMVSGTLLSASPSLAQQQNPPPADTSSQGQAKTAAKSGDNKDPAIEEKKSPENDRLFFVLPNYLTVENAKNIPPLTTGQKFKLVALGAFDPFEYPYVGIIA
Ga0314861_0190715_1_3633300033977PeatlandMINRNWWAPTFVFDATVICTLLLAFPLLAQQQSPASADTSSQGQSKPGEKSGDNKDPAIQEQKKPENDRIFWTLPNYLTVENAKQIPPLTTGQKFKLVALGTFDPVEYPYVGVLALIDQA
Ga0371487_0231189_1_3213300033982Peat SoilMISRSRWTVTFALGAMVSGTLLSASPSLAQQQNPPPADTSSQGQAKTAAKSGDNKDPAIEEKKSPENDRLFFVLPNYLTVENAKNTPPLTTGQKFKLVALGVFDPIE
Ga0371488_0254448_1_2523300033983Peat SoilMISRNRCTVTFALGVMVIGALLSAFPSLAQQQNPPPADTSSQGQSKTGAKSADNKDPAIQEKKSPENDRLFFVLPNYLTVENAK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.