NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091260

Metagenome Family F091260

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091260
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 80 residues
Representative Sequence MIQNGDSSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCSALDDLTLSIDAFEEEMKAKINDALSNSVEA
Number of Associated Samples 89
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 89.72 %
% of genes near scaffold ends (potentially truncated) 14.02 %
% of genes from short scaffolds (< 2000 bps) 85.98 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (92.523 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(21.495 % of family members)
Environment Ontology (ENVO) Unclassified
(47.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(35.514 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 70.64%    β-sheet: 0.00%    Coil/Unstructured: 29.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13412HTH_24 5.61
PF03551PadR 4.67
PF09084NMT1 0.93
PF13191AAA_16 0.93
PF03091CutA1 0.93
PF13673Acetyltransf_10 0.93
PF13426PAS_9 0.93
PF00583Acetyltransf_1 0.93
PF04055Radical_SAM 0.93
PF05048NosD 0.93
PF13237Fer4_10 0.93
PF00589Phage_integrase 0.93
PF00174Oxidored_molyb 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 4.67
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 4.67
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 4.67
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 0.93
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.93
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.93
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.52 %
UnclassifiedrootN/A7.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003432|JGI20214J51088_10019659All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4574Open in IMG/M
3300003852|Ga0031655_10017327All Organisms → cellular organisms → Archaea → TACK group3521Open in IMG/M
3300004011|Ga0055460_10229763All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon585Open in IMG/M
3300009009|Ga0105105_10203033All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1028Open in IMG/M
3300009037|Ga0105093_10069299All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1641Open in IMG/M
3300009078|Ga0105106_10275462All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1220Open in IMG/M
3300009078|Ga0105106_11113290All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon561Open in IMG/M
3300009081|Ga0105098_10602997All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon572Open in IMG/M
3300009085|Ga0105103_10623980All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon614Open in IMG/M
3300009146|Ga0105091_10191650All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon971Open in IMG/M
3300009146|Ga0105091_10472535All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon633Open in IMG/M
3300009153|Ga0105094_10439501All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon757Open in IMG/M
3300009166|Ga0105100_10190176All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1222Open in IMG/M
3300009168|Ga0105104_10176157All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1160Open in IMG/M
3300009519|Ga0116108_1101178All Organisms → cellular organisms → Archaea872Open in IMG/M
3300009552|Ga0116138_1208936Not Available539Open in IMG/M
3300009623|Ga0116133_1116657All Organisms → cellular organisms → Archaea → TACK group686Open in IMG/M
3300009636|Ga0116112_1227832All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon515Open in IMG/M
3300009641|Ga0116120_1088412All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1030Open in IMG/M
3300009643|Ga0116110_1022700All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2414Open in IMG/M
3300009643|Ga0116110_1280531All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon531Open in IMG/M
3300009644|Ga0116121_1095357All Organisms → cellular organisms → Archaea932Open in IMG/M
3300009645|Ga0116106_1151668All Organisms → cellular organisms → Archaea741Open in IMG/M
3300009680|Ga0123335_1004746All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon17185Open in IMG/M
3300009764|Ga0116134_1172357All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon758Open in IMG/M
3300010339|Ga0074046_10568668All Organisms → cellular organisms → Archaea → TACK group673Open in IMG/M
3300010341|Ga0074045_10465336All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon815Open in IMG/M
3300010379|Ga0136449_102123437All Organisms → cellular organisms → Archaea → TACK group823Open in IMG/M
3300014159|Ga0181530_10650155Not Available512Open in IMG/M
3300014490|Ga0182010_10829706All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon525Open in IMG/M
3300014491|Ga0182014_10025456All Organisms → cellular organisms → Archaea → TACK group4781Open in IMG/M
3300014491|Ga0182014_10087132All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1931Open in IMG/M
3300014496|Ga0182011_10390864All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon909Open in IMG/M
3300014498|Ga0182019_10623888All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon759Open in IMG/M
3300014502|Ga0182021_10009549All Organisms → cellular organisms → Archaea → TACK group11502Open in IMG/M
3300014502|Ga0182021_10035375All Organisms → cellular organisms → Archaea → TACK group5862Open in IMG/M
3300014502|Ga0182021_10070560All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4057Open in IMG/M
3300014502|Ga0182021_10785883All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1143Open in IMG/M
3300014502|Ga0182021_13441140All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon527Open in IMG/M
3300014838|Ga0182030_11295235All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon615Open in IMG/M
3300015214|Ga0172382_10676679All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon724Open in IMG/M
3300017925|Ga0187856_1008044All Organisms → cellular organisms → Archaea6396Open in IMG/M
3300017926|Ga0187807_1126420All Organisms → cellular organisms → Archaea → TACK group811Open in IMG/M
3300017929|Ga0187849_1398034All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon502Open in IMG/M
3300017935|Ga0187848_10036409All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2447Open in IMG/M
3300017938|Ga0187854_10362506All Organisms → cellular organisms → Archaea611Open in IMG/M
3300017946|Ga0187879_10499124All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon675Open in IMG/M
3300017946|Ga0187879_10660997All Organisms → cellular organisms → Archaea → TACK group581Open in IMG/M
3300017972|Ga0187781_10579075All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon808Open in IMG/M
3300017972|Ga0187781_10767840All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon699Open in IMG/M
3300017973|Ga0187780_10237485All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1275Open in IMG/M
3300017974|Ga0187777_10733520All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon702Open in IMG/M
3300017988|Ga0181520_10347579All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1092Open in IMG/M
3300017988|Ga0181520_10426144All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon956Open in IMG/M
3300018002|Ga0187868_1179355All Organisms → cellular organisms → Archaea → TACK group749Open in IMG/M
3300018003|Ga0187876_1229176All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon613Open in IMG/M
3300018013|Ga0187873_1175465All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon810Open in IMG/M
3300018014|Ga0187860_1163071All Organisms → cellular organisms → Archaea944Open in IMG/M
3300018017|Ga0187872_10153850All Organisms → cellular organisms → Archaea → TACK group1097Open in IMG/M
3300018019|Ga0187874_10036504All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2382Open in IMG/M
3300018020|Ga0187861_10299568Not Available689Open in IMG/M
3300018024|Ga0187881_10107312All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1256Open in IMG/M
3300018025|Ga0187885_10280661All Organisms → cellular organisms → Archaea → TACK group756Open in IMG/M
3300018033|Ga0187867_10449986All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon711Open in IMG/M
3300018034|Ga0187863_10260435All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon964Open in IMG/M
3300018038|Ga0187855_10418037All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon781Open in IMG/M
3300018044|Ga0187890_10637142Not Available601Open in IMG/M
3300018046|Ga0187851_10756927Not Available547Open in IMG/M
3300018057|Ga0187858_10238266All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1172Open in IMG/M
3300018057|Ga0187858_10519147All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon726Open in IMG/M
3300018062|Ga0187784_10010770All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon7382Open in IMG/M
3300018062|Ga0187784_10725738All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon794Open in IMG/M
3300018062|Ga0187784_11250641All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon589Open in IMG/M
3300018085|Ga0187772_10462422All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon890Open in IMG/M
3300018086|Ga0187769_10606939All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon827Open in IMG/M
3300018090|Ga0187770_11059667All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon653Open in IMG/M
3300019082|Ga0187852_1211474All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon797Open in IMG/M
3300022526|Ga0224533_1078800Not Available544Open in IMG/M
3300023311|Ga0256681_12118586All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon946Open in IMG/M
3300025506|Ga0208937_1084102All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon716Open in IMG/M
3300026311|Ga0209723_1001628All Organisms → cellular organisms → Archaea33985Open in IMG/M
3300026450|Ga0247847_1050914All Organisms → cellular organisms → Archaea → TACK group551Open in IMG/M
3300027693|Ga0209704_1116473All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon765Open in IMG/M
3300027723|Ga0209703_1319417All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon547Open in IMG/M
3300027726|Ga0209285_10045337All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1294Open in IMG/M
3300027762|Ga0209288_10189534All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon669Open in IMG/M
3300027792|Ga0209287_10035868All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1807Open in IMG/M
3300027792|Ga0209287_10145360All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon898Open in IMG/M
3300027896|Ga0209777_10001886All Organisms → cellular organisms → Archaea28870Open in IMG/M
3300027896|Ga0209777_10466525All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon938Open in IMG/M
3300027899|Ga0209668_10856991All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon612Open in IMG/M
3300027902|Ga0209048_10249820All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1264Open in IMG/M
3300027902|Ga0209048_10405005All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon936Open in IMG/M
3300027972|Ga0209079_10130748All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon860Open in IMG/M
3300027979|Ga0209705_10582622All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon537Open in IMG/M
3300031949|Ga0214473_10393241All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1566Open in IMG/M
3300032160|Ga0311301_12392805All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon596Open in IMG/M
3300032173|Ga0315268_11203270All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon767Open in IMG/M
3300032342|Ga0315286_10648771All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1083Open in IMG/M
3300032783|Ga0335079_11614079All Organisms → cellular organisms → Archaea → TACK group637Open in IMG/M
3300032783|Ga0335079_12259262Not Available518Open in IMG/M
3300032805|Ga0335078_11551795All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon737Open in IMG/M
3300032829|Ga0335070_10754328Not Available907Open in IMG/M
3300032892|Ga0335081_11380010All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon789Open in IMG/M
3300033158|Ga0335077_11121653All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon776Open in IMG/M
3300033402|Ga0326728_10119046All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3049Open in IMG/M
3300033405|Ga0326727_10686863All Organisms → cellular organisms → Archaea → TACK group823Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland21.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment17.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland10.28%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland9.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.48%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment5.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.80%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.80%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.87%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009680Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNAEngineeredOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015214Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaGEngineeredOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300022526Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026311Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300026450Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20214J51088_1001965963300003432WetlandMIQNGDNSIKDRIKSDVLQEIQRILLTYEERIAVLEKENRLLWEDNRKFRIMLDDLSLSIDAFEEELKAKINDAISKFTEA*
Ga0031655_1001732753300003852Freshwater Lake SedimentMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTFSIDAFEEEMKAKINDVLSNWTEP*
Ga0055460_1022976323300004011Natural And Restored WetlandsMIQGGDSSIRDRIKSDVLHEVQRILLTYEERIAVLEKENRQLWEENRTLYSALDDLSLSFDDFEEEIKAKLNDAISNLAEA*
Ga0105105_1020303323300009009Freshwater SedimentMIQGGDSSIRDRIKTDVLQEVQRILLTYEERIAVLEKENRLLWEENRKLCSILDDLTLSIVTFEEEVKTKLNDALLNYMYLNEQICC*
Ga0105093_1006929923300009037Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAFFEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTEP*
Ga0105106_1027546233300009078Freshwater SedimentLIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRVLWEENRKLCSGLDDLTFSIDAFEEEMKAKINDALSNWTEP*
Ga0105106_1111329023300009078Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERLAFLEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTKP*
Ga0105098_1060299723300009081Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTFEERIAFLEKENRLLWEENRKFFSALDDLTLFIDVFEEEMKEKLNDALSNWTEP*
Ga0105103_1062398023300009085Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAILEKENRLLWEENRKFFSALDDLTLFIDVFEEEMKEKLNDALSNWTEP*
Ga0105091_1019165013300009146Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAILEKENRLLWEENRKFFSALDDLTLFIDVFEEEMKEKLNDA
Ga0105091_1047253523300009146Freshwater SedimentMIQNGDNSIGDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENKKLCIALDDLTFSIDAFEEEMKAKINDAISNWAET*
Ga0105094_1043950123300009153Freshwater SedimentMIQNGDNSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTEP*
Ga0105100_1019017633300009166Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLSIDAFEEEM
Ga0105104_1017615713300009168Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLSAEAFEEEMKAKINDTLTNWTEP*
Ga0116108_110117823300009519PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA*
Ga0116138_120893623300009552PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNYVGA*
Ga0116133_111665723300009623PeatlandMIQNGDSSIRDRIKSDVLQELQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLGNDAFEEEMKAKINDALSNLAEA*
Ga0116112_122783213300009636PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTLSVDAFEEEMKAKINDAYSNAAEA*
Ga0116120_108841223300009641PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTFSVDAFEEEMKAKINDAYSNAAEG*
Ga0116110_102270023300009643PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLGIDAFEEEMKAKINDALSNWTET*
Ga0116110_128053123300009643PeatlandFWRQATMIQNGDSSIRDKIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLCIDAFEEEMKAKINDALSNSVEA*
Ga0116121_109535713300009644PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCNGLDDLTLGIDAFEEEM
Ga0116106_115166823300009645PeatlandMIQKGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCITLDDLAFSVEAFEEEMKAKINDVLSTWTEP*
Ga0123335_100474673300009680Anaerobic Biogas ReactorVIQGGDNSIRERIKSDVLQEIQRILLTYEERIAVLEKENRQLWEQNRTLYSALDDLSISIDDFEEEIKAKLNDAISNLAEA*
Ga0116134_117235713300009764PeatlandMIQNGDNSIRERIKSNVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLGIGAFEEEMKAKINDALSNWAEA*
Ga0074046_1056866823300010339Bog Forest SoilMIQNGDSSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCISLDDLTLCIDAFEEEMKAKINDALSNSVEA*
Ga0074045_1046533613300010341Bog Forest SoilMMIQNGDSSIRERIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCNALDDLTLCIDASEEEMKAKINNALSTWTEP*
Ga0136449_10212343713300010379Peatlands SoilMIQNGDNSIRDRIKSDILQEVQRVLLTYEERIAALEKENRLLWEENRKLYTALDDLTLFIDAFEEEMKAKINNALSNWVEA*
Ga0181530_1065015523300014159BogGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA*
Ga0182010_1082970613300014490FenLIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRVLWEENRKLCSGLDDLTFSIDAFEEEMKAKINDALSNLAET*
Ga0182014_1002545653300014491BogMIQSGDNSIRERIKSDVLQEVQHVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLCIDAFEEEMKAKINDALSNWTEP*
Ga0182014_1008713233300014491BogMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRVLWEEKRKLCSALDDLTLSIDAFEEEMKAKINDALSNLAES*
Ga0182011_1039086413300014496FenMIQNGDSSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCSALDDLTLSIDAFEEEMKAKINDALSNSVEA*
Ga0182019_1062388823300014498FenMIQNGDNSIRDRIKSDVLQVVQRVLLTYEERIAVLEKENRLLWEENRKLCIAFDDLTLSVDAFEEEMKAKINESLSNWTEA*
Ga0182021_10009549113300014502FenMIQSGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLGIVLDDLTFSVDAFEEEMKAKINDAVSNWAET*
Ga0182021_1003537523300014502FenMIQGGDSSIRERIKFEVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLCIDAFEEEMTAKINDALSKWAEA*
Ga0182021_10070560103300014502FenMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRVLWEEKRKLCIALDDLTFSIDAFEEEMKAKINDAVSNWAET*
Ga0182021_1078588323300014502FenMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTFSIDAFEEEMKAKINEALSNWTES*
Ga0182021_1344114013300014502FenMIQNGDNSIRERIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLGIVLDDLTFSIDAFEEEMKAKINDAVSNWAET*
Ga0182030_1129523513300014838BogMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCNALDDLTLCIDAFEEEMKAKINDALSNWVEV*
Ga0172382_1067667923300015214Landfill LeachateMIQGGDSSIRDKIKSDVLQEIQRILLCYEERIAVLERDNRLLWEKTKTLCSALDDLFLFIDAFEEEIKAKINDAISNWAEV*
Ga0187856_100804463300017925PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTFSVDAFEEEMKAKINDAYSNAAEA
Ga0187807_112642023300017926Freshwater SedimentMIQSGDSSIKERIRSDVLQEVQRVLLTYEERIAILEKENRQLWEENRKLCSALDDLTLSVDAFQEEMKAKNNEALSNWVEA
Ga0187849_139803423300017929PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCNALDGLTLSVDAFEEEMKAKINDALSNWAEA
Ga0187848_1003640933300017935PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187854_1036250613300017938PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKA
Ga0187879_1049912423300017946PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187879_1066099723300017946PeatlandGMIQNGGSSIKDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187781_1057907523300017972Tropical PeatlandMIQNSDNSIRDRIKSDFLQEIQHILLTYEERIAVLEKENQLLWEENRKLCNGLDDLTLSVDAFEEGLRAKINSALSNLAEA
Ga0187781_1076784013300017972Tropical PeatlandMIQNGDNSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCCALDDLTLSVDAFEEELKAKMNEALSNLAEA
Ga0187780_1023748523300017973Tropical PeatlandMIQNGENSIRDRIKSDVLQEIQRILLTYEERIAVLEKENRLLWEENRKLCNGLDDLTLSVDAFEEELKAKINDALSNLAEA
Ga0187777_1073352023300017974Tropical PeatlandMIKNGYNSIRERIKSDVLQEIQRVLLTYEERIAVLEKEYRLLWEENRKLCLALDDLTFSIYAFEEEMKAKMNDALFNWAEP
Ga0181520_1034757913300017988BogIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0181520_1042614413300017988BogMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCNALDDLTLSVDAFEEEMKAKINDALLSLTEA
Ga0187868_117935523300018002PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTLSVDASEEEMKAKINDALSNAAEA
Ga0187876_122917613300018003PeatlandSGDNSIRDRIKFDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTFSVDAFEEEMKAKINDAYSNAAEA
Ga0187873_117546523300018013PeatlandMIQNGDNSIRERIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187860_116307113300018014PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWKENRKLSITLDDLTLCNDAFEEEMKAKINDALSNWAEA
Ga0187872_1015385023300018017PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTLSVDAFEEEMKAKINDALSNAAEA
Ga0187874_1003650423300018019PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEQNRKLSSALDDLTLSVDAFEEEMKPKINDAVSNWTEP
Ga0187861_1029956813300018020PeatlandMIQSGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLGIVLEDLTFSIDAFEEEMKAKINDALSNWAGA
Ga0187881_1010731223300018024PeatlandMIQNGESSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187885_1028066123300018025PeatlandMIQKGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCSSLDDLTLCIDAFEEEMKAKINDALSNWAEA
Ga0187867_1044998613300018033PeatlandMIQNGDNSIRDRIKSDVLYEVQRVLLTYEERIAVLEKENRLLWEENRKLCSALDDLTLCIDAFEEEMKAKINDALSNWAEA
Ga0187863_1026043543300018034PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCSALDDLTFSFDAFEEEMKAKINNALSNLAEA
Ga0187855_1041803723300018038PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTFSVDAFEEEMKAKINDALSNYVGA
Ga0187890_1063714223300018044PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLSIALDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0187851_1075692723300018046PeatlandMIQNGSSSIKDRIKSDVLQEVQRVLLTYEERIAVLEKENLLLWEENRKLCITLDDLTLFVDAFDEEMKAKINDGLS
Ga0187858_1023826643300018057PeatlandMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCSSLDDLTLCIDAFEEEMKAKINDALSNWAEA
Ga0187858_1051914723300018057PeatlandMIQSGDNSIRDRIKFDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIMLDDLTFSVDAFEEEMKAKINDAYSNAAEA
Ga0187784_1001077073300018062Tropical PeatlandMIQNSDNSIRDRIKSDVLQEIQRILLTYEERIAVLEKENQLLWEENRKLCNGLDDLTLSVDAFEEGLRAKINSALSNLAEA
Ga0187784_1072573813300018062Tropical PeatlandMMKNSDNSIRDRIKSDVLQEVQRILLTYEERIAVLEKENQLLWEANRKLYNALDDLTISLDAFKEEQSENE
Ga0187784_1125064123300018062Tropical PeatlandMIQNSDNSIRDRIKSDVLQEIQRILLTYEERIAVLEKENRLLWEENRKLCNGLDDLTLSIDTFEEELRAKINDALSNLAEA
Ga0187772_1046242223300018085Tropical PeatlandMMIQNGDNSIRDRIKSDVLQEIQRVLLTYEERMSVLEKENRLLWEENRKLCCALEDLTLSVDVFKEESKVKMIEALSNLAEA
Ga0187769_1060693913300018086Tropical PeatlandMIQNSDNSIRERIKSDVLQEIQRILLTYEERIAVLEKENRLLWEENRKLCNGLDDLTLSVDAFEEELKAKINDALSNLAEA
Ga0187770_1105966723300018090Tropical PeatlandMIQNSDNSIRDRIKSDVLREIQRILLTYEERIAVLEKENRLLWEENRKLCNGLDDLTLSVDAFEEKSKAKINDALSNLAEA
Ga0187852_121147413300019082PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRNLCSALDDLTLCIDAFEEEMKAKINDALSNPVEA
Ga0224533_107880023300022526SoilMIQNGDSSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCSGLDDLTFSIEAFEEEMKAKINDALSNWTEP
Ga0256681_1211858623300023311FreshwaterLIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCRALDDLTFSFDAFEEEMKAKINDALSNLAET
Ga0208937_108410223300025506PeatlandMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLSITLDDLTLCNDAFEEEMKAKINDALSNSVEA
Ga0209723_1001628183300026311Anaerobic Biogas ReactorVIQGGDNSIRERIKSDVLQEIQRILLTYEERIAVLEKENRQLWEQNRTLYSALDDLSISIDDFEEEIKAKLNDAISNLAEA
Ga0247847_105091423300026450SoilSSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCSALDDLTLSIDAFEEEMKAKINDALSNSVEA
Ga0209704_111647323300027693Freshwater SedimentMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAILEKENRLLWEENRKLCSLLDDLSLSIDAFEEEMKAKINDTLANWAEA
Ga0209703_131941713300027723Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAFFEKENRLLWEENRKFFSALDDLTLFIDVFEEEMKEKLNDAL
Ga0209285_1004533733300027726Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAFLEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTEP
Ga0209288_1018953413300027762Freshwater SedimentTMIQGGDSSIRDRIKTDVLQEVQRILLTYEERIAVLEKENRLLWEENRKLCSILDDLTLSIVTFEEEVKTKLNDALLNYMYLNEQICC
Ga0209287_1003586843300027792Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAFFEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTEP
Ga0209287_1014536013300027792Freshwater SedimentMIQGGDSSIRDRIKTDVLQEVQRILLTYEERIAVLEKENRLLWEENRKLCSILDDLTLSIVTFEEEVKTKLNDALLNYMYLNEQICC
Ga0209777_10001886113300027896Freshwater Lake SedimentMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTFSIDAFEEEMKAKINDVLSNWTEP
Ga0209777_1046652523300027896Freshwater Lake SedimentMIQNGDNSIRDRIKSNVSQEVQRVLLTYEERIAVLEKENRLLWEENRKICIAFDDLTLSVDAFEEEMKAKINEALSNWVET
Ga0209668_1085699113300027899Freshwater Lake SedimentMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEEQRKLCSGLDDLTFSIDAFEEEMKAKINDALSNLAET
Ga0209048_1024982023300027902Freshwater Lake SedimentMIQNADNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCSTFDDLTLSVDAFEEEMKAKINEALSNWVEA
Ga0209048_1040500513300027902Freshwater Lake SedimentPTMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKFFSALDDLTFSIDAFEEEMKAKINDALSNWTEP
Ga0209079_1013074823300027972Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAILEKENRLLWEENRKFFSALDDLTLFIDVFEEEMKEKLNDALSNWTEP
Ga0209705_1058262213300027979Freshwater SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAILEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKINNALSNWTEP
Ga0214473_1039324123300031949SoilLIQNGDNSIRDKIKSDVLKEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLSAEAFEEEMKAKINDALSNLAEP
Ga0311301_1239280523300032160Peatlands SoilMIQNGDNSIRDRIKSDILQEVQRVLLTYEERIAALEKENRLLWEENRKLYTALDDLTLFIDAFEEEMKAKINNALSNWVEA
Ga0315268_1120327013300032173SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERLAFLEKENRLLWEENRKFFSALDDLTLSIDAFEEEMKEKLNDVLSNWTEP
Ga0315286_1064877133300032342SedimentMIQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTFSIEAFEEEMKAKINDALSNWTEP
Ga0335079_1161407913300032783SoilMIQHGDNSIRDRIKSDVLQEIQRVLLAYEERIAVIEKENRQLWEENRKLCNALDDLTSSVDAFQEEMKAKINQTLSNWTEA
Ga0335079_1225926223300032783SoilMIQSGDSSIKERIRSDVLQEVQRVLLTYEERIAFLEKENRQLWEENRKLCSALYDLTLSVDAFEEEMKTKVNDALSNAAEA
Ga0335078_1155179513300032805SoilMIQSRDSSIRDRIRSDVLQEVQRVLLTYEERIAVLEKENRLLWEETRKFCSALDDLTLSVHAYEKEMKAKINDALSIAAEA
Ga0335070_1075432813300032829SoilMIQSGDSSIRDRIRSGVLQKVRRVLLTYEERIAALEKENHQLWEENRKLFSALDDLTLSVEAFEEEMKAKINEALSNLAGA
Ga0335081_1138001013300032892SoilQNGDNSIRDRIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKFCSMLDDLTLSVDAFEEETKAKINNALSNAAEA
Ga0335077_1112165313300033158SoilMIQNGDSSIRDRIKSDVLQEIQRVLLTYEERIAVLEKENRLLWEENRKLCNALDNLTLSVDAFEEEMKAKINDALSNLVEA
Ga0326728_1011904633300033402Peat SoilMIQHGDNSIRDRIKSDVLQEVQRVLLIYEERIAVLEKGNSQIWEENRKLCNALDDLTLSVEAFQEEMKAKINDALSNWAGA
Ga0326727_1068686313300033405Peat SoilMIQNGDNSIRERIKSDVLQEVQRVLLTYEERIAVLEKENRLLWEENRKLCIALDDLTLCIDAFEEEMKAKINDALSNWVEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.