Basic Information | |
---|---|
Family ID | F091498 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | VLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTV |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 42.06 % |
% of genes from short scaffolds (< 2000 bps) | 38.32 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.682 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (27.103 % of family members) |
Environment Ontology (ENVO) | Unclassified (71.028 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.897 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 78.57% Coil/Unstructured: 21.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF10030 | DUF2272 | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.68 % |
All Organisms | root | All Organisms | 38.32 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003393|JGI25909J50240_1030981 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
3300004793|Ga0007760_10032475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
3300005581|Ga0049081_10298578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300007214|Ga0103959_1036095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2730 | Open in IMG/M |
3300007622|Ga0102863_1019113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1924 | Open in IMG/M |
3300008116|Ga0114350_1160454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300008450|Ga0114880_1009649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4808 | Open in IMG/M |
3300009158|Ga0114977_10033935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3195 | Open in IMG/M |
3300009164|Ga0114975_10036337 | All Organisms → Viruses → Predicted Viral | 2936 | Open in IMG/M |
3300009183|Ga0114974_10712862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300009184|Ga0114976_10296358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300011009|Ga0129318_10111765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300012702|Ga0157596_1129217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
3300012708|Ga0157595_1184392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
3300012712|Ga0157598_1223540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300012716|Ga0157605_1060237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300012726|Ga0157597_1211598 | Not Available | 1218 | Open in IMG/M |
3300012726|Ga0157597_1277318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300012764|Ga0157624_1101587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
3300012764|Ga0157624_1188646 | Not Available | 581 | Open in IMG/M |
3300012779|Ga0138284_1342609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
3300013372|Ga0177922_10521181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300017701|Ga0181364_1050957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300017701|Ga0181364_1061447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017736|Ga0181365_1055959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300017747|Ga0181352_1161991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300017754|Ga0181344_1119566 | Not Available | 759 | Open in IMG/M |
3300020151|Ga0211736_10755024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300020162|Ga0211735_10916279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1654 | Open in IMG/M |
3300020550|Ga0208600_1045094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300022198|Ga0196905_1179023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300024483|Ga0255224_1107593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300024560|Ga0256306_1062972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300024569|Ga0255243_1088676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300027732|Ga0209442_1111962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
3300027743|Ga0209593_10083261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300027759|Ga0209296_1407568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300027763|Ga0209088_10116748 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
3300027974|Ga0209299_1078441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1172104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300033981|Ga0334982_0394184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300034023|Ga0335021_0594936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300034066|Ga0335019_0326639 | Not Available | 956 | Open in IMG/M |
3300034105|Ga0335035_0273591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300034119|Ga0335054_0235856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 27.10% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.69% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.76% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.80% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.87% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.87% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.93% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015243 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29590_1060243 | 3300002278 | Freshwater | QLIMSILAVIPNGYIVGEVERPTVTTIGASTMLISDIRVSTYYEQTI* |
B570J29032_1095520753 | 3300002408 | Freshwater | VISVLAVIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTI* |
JGI25909J50240_10309814 | 3300003393 | Freshwater Lake | VISVLAVIPSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI* |
JGI25911J50253_1000141918 | 3300003411 | Freshwater Lake | ISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
JGI25923J51411_10842302 | 3300003493 | Freshwater Lake | MSVLAVIPTGYVVSSVERPTVSQVGASTLLIADVRVSTYYTQTA* |
Ga0065166_103424661 | 3300004112 | Freshwater Lake | AVIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0007760_100324754 | 3300004793 | Freshwater Lake | IEQLIISVLAVIPTGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI* |
Ga0068876_106790862 | 3300005527 | Freshwater Lake | PAGYIVSSVERPTVTQVGAATLLIADVRVSTYYQRTI* |
Ga0049081_102985781 | 3300005581 | Freshwater Lentic | PVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0078894_112611501 | 3300005662 | Freshwater Lake | AVIPVGYIVSSVERPTVSQVGASTLLIADVRVSTYYTQTV* |
Ga0075459_10930011 | 3300006863 | Aqueous | VLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTV* |
Ga0103959_10360951 | 3300007214 | Freshwater Lake | GYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0102863_10191131 | 3300007622 | Estuarine | EQLIMSVLAVIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0102859_11435291 | 3300007708 | Estuarine | YVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0105745_11851271 | 3300007972 | Estuary Water | SVLAVIPSGYIVSSVERPTVQQVGASTLLIADVRVSTYYTQTA* |
Ga0114350_11604542 | 3300008116 | Freshwater, Plankton | SLDNIEQLIISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0114876_12281132 | 3300008448 | Freshwater Lake | LAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0114880_10096498 | 3300008450 | Freshwater Lake | YIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0114977_100339351 | 3300009158 | Freshwater Lake | PVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0114978_100375851 | 3300009159 | Freshwater Lake | PVGYIVSSVERPTVSQVGASTLLIADVRVSTYYTQTV* |
Ga0114975_100363371 | 3300009164 | Freshwater Lake | GYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0105097_105334251 | 3300009169 | Freshwater Sediment | TMSVLKVIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0105096_103265523 | 3300009170 | Freshwater Sediment | IISVLAVIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0114974_107128621 | 3300009183 | Freshwater Lake | TGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0114976_102963581 | 3300009184 | Freshwater Lake | EQLIISVLAVIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0129318_101117651 | 3300011009 | Freshwater To Marine Saline Gradient | NIEQLIISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0157596_10285291 | 3300012702 | Freshwater | PAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTI* |
Ga0157596_11292174 | 3300012702 | Freshwater | IISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0157627_11353121 | 3300012706 | Freshwater | SGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157595_11843924 | 3300012708 | Freshwater | PSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157598_12235404 | 3300012712 | Freshwater | VIPSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157601_11812362 | 3300012714 | Freshwater | AGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTV* |
Ga0157605_10602373 | 3300012716 | Freshwater | DNIEQLLISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157605_10893394 | 3300012716 | Freshwater | SVLAVIPSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157630_12533653 | 3300012722 | Freshwater | AGYIVSSVERPAVTQVGASTLLIADVRVSTYYTRTI* |
Ga0157610_11788771 | 3300012725 | Freshwater | IPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157597_12115984 | 3300012726 | Freshwater | PAGYIVSSVERPTVTQVGASTLLIADVRVSTYYQRTI* |
Ga0157597_12773181 | 3300012726 | Freshwater | QLVISVLAVIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTV* |
Ga0157602_10653364 | 3300012730 | Freshwater | VIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYQRTI* |
Ga0138285_10760132 | 3300012758 | Freshwater Lake | IPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0157626_11158953 | 3300012759 | Freshwater | VIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0157624_11015874 | 3300012764 | Freshwater | IPSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0157624_11886462 | 3300012764 | Freshwater | NIEQLVISVLAVIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYQRTI* |
Ga0138276_10414281 | 3300012768 | Freshwater Lake | IPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI* |
Ga0138287_11026491 | 3300012772 | Freshwater Lake | PTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA* |
Ga0138287_11462261 | 3300012772 | Freshwater Lake | IPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0138284_12687741 | 3300012779 | Freshwater Lake | GGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI* |
Ga0138284_13426091 | 3300012779 | Freshwater Lake | QLIMRVLAVIPVGYIVSSVERPTVSQVGASTLLISDIRVSTYYTQTT* |
Ga0138286_10466333 | 3300012781 | Freshwater Lake | VLAVIPVGYIVSSVERPTVSQVGASTLLIADVRVSTYYTQTI* |
Ga0138286_11778793 | 3300012781 | Freshwater Lake | VGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0170791_152684421 | 3300013295 | Freshwater | VLAVIPNGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI* |
Ga0177922_105211812 | 3300013372 | Freshwater | ASLDNIEQLVISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV* |
Ga0180041_1535432 | 3300015243 | Freshwater | VGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI* |
Ga0181364_10509572 | 3300017701 | Freshwater Lake | NIEQLVISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0181364_10614471 | 3300017701 | Freshwater Lake | IISVLAVIPTGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI |
Ga0181365_10559591 | 3300017736 | Freshwater Lake | NIEQLVISVLAVIPSGYIVSSVERPTVQQVGASTLLIADVRVSTYYTRTI |
Ga0181352_11619911 | 3300017747 | Freshwater Lake | QLIISVLAVIPTGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI |
Ga0181344_11195661 | 3300017754 | Freshwater Lake | NIEQLVISVLAVIPAGYIVSSVERPTVTQVGAATLLIADVRVSTYYQRTI |
Ga0181356_11791513 | 3300017761 | Freshwater Lake | IPTDYMVSPVERPTVTTVGASTLLSVDVRVSTYYTRPD |
Ga0181343_11933312 | 3300017766 | Freshwater Lake | GYIVGSVERPTVTQVGASTLLIADVRVSTYYTRTI |
Ga0181358_10403835 | 3300017774 | Freshwater Lake | AVIPNGYIVGSVERPTVTQVGASTLLIADVRVSTYYTRTI |
Ga0211736_107550242 | 3300020151 | Freshwater | VISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0211735_109162791 | 3300020162 | Freshwater | ISVLAVIPTGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI |
Ga0208600_10450943 | 3300020550 | Freshwater | VLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0196905_11790232 | 3300022198 | Aqueous | SLDNIEQLVISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI |
Ga0181351_11518283 | 3300022407 | Freshwater Lake | AVIPTGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0255224_11075932 | 3300024483 | Freshwater | GYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0255186_10593791 | 3300024512 | Freshwater | SVLAVIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0255225_10533613 | 3300024537 | Freshwater | VGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0256306_10629723 | 3300024560 | Freshwater | KDKPTSRPVITTVAMISPYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0255243_10886763 | 3300024569 | Freshwater | IEQLIISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0256344_11058861 | 3300024860 | Freshwater | MSVLAVIPVGYVVSVVERPTVTQVGASTLLIADVRVSTYYTQTT |
Ga0208800_10434381 | 3300027193 | Estuarine | VLAVIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTT |
Ga0255093_10509351 | 3300027492 | Freshwater | LAVIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0208974_10306921 | 3300027608 | Freshwater Lentic | LAVIPNGYVVSSVERPTVSQVGASTLLIADVRVSTYYTQTA |
Ga0209357_10150966 | 3300027656 | Freshwater Lake | MSVLAVIPTGYVVSSVERPTVSQVGASTLLIADVRVSTYYTQTA |
Ga0209551_11990582 | 3300027689 | Freshwater Lake | LVISVLAVIPVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209442_11119621 | 3300027732 | Freshwater Lake | AVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0209087_11968443 | 3300027734 | Freshwater Lake | GYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209593_100832614 | 3300027743 | Freshwater Sediment | LIISVLAVIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209296_10593935 | 3300027759 | Freshwater Lake | LIISVLAVIPSGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209296_14075682 | 3300027759 | Freshwater Lake | IEQLIMSVLAAIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0209088_101167484 | 3300027763 | Freshwater Lake | AVIPVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209768_100832921 | 3300027772 | Freshwater Lake | ISVLAVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209500_103351682 | 3300027782 | Freshwater Lake | PVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209079_103247641 | 3300027972 | Freshwater Sediment | AVIPAGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0209299_10784411 | 3300027974 | Freshwater Lake | DNIEQLIISVLAVIPNGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTI |
Ga0247723_11368792 | 3300028025 | Deep Subsurface Sediment | GYVVSSVERPTVSQVGASTLLIADVRVSTYYTQTA |
(restricted) Ga0247838_11721043 | 3300028044 | Freshwater | DNIEQLVISVLAVIPVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0256335_11774662 | 3300028112 | Freshwater | VIPVGYVVSVVERPTVTQVGASTLLIADVRVSTYYTQTT |
(restricted) Ga0247842_103578161 | 3300029268 | Freshwater | IISVLAVIPVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0315278_106427111 | 3300031997 | Sediment | IMSVLAAIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0315278_121700111 | 3300031997 | Sediment | VLAVIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0315289_113397361 | 3300032046 | Sediment | GYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0315295_115765372 | 3300032156 | Sediment | SVLAVIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0315276_105932834 | 3300032177 | Sediment | AAIPTGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0315273_122098063 | 3300032516 | Sediment | TGYVVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0334982_0394184_1_153 | 3300033981 | Freshwater | NIEQLIISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0335021_0594936_391_549 | 3300034023 | Freshwater | LDNIEQLIISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0334995_0522522_592_708 | 3300034062 | Freshwater | IPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTA |
Ga0335019_0326639_3_152 | 3300034066 | Freshwater | IEQLVISVLAVIPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYQRTI |
Ga0335027_0498315_1_111 | 3300034101 | Freshwater | AGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0335035_0273591_867_1007 | 3300034105 | Freshwater | LIISVLAVIPVGYIVSSVERPTVTQVGASTLLIADVRVSTYYTQTI |
Ga0335050_0285449_676_795 | 3300034108 | Freshwater | VIPVGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0335054_0235856_972_1091 | 3300034119 | Freshwater | VIPGGYIVSSVERPTVTTVGASTLLIADVRVSTYYTRTV |
Ga0335007_0103087_1984_2109 | 3300034283 | Freshwater | LAVIPAGYIVSSVERPTVTQVGAATLLIADVRVSTYYTRTI |
Ga0335007_0441162_684_800 | 3300034283 | Freshwater | IPAGYIVSSVERPTVTQVGASTLLIADVRVSTYYTRTI |
⦗Top⦘ |