NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091801

Metagenome Family F091801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091801
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence VYAVVLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 88.79 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(28.972 % of family members)
Environment Ontology (ENVO) Unclassified
(36.449 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.879 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.29%    β-sheet: 0.00%    Coil/Unstructured: 45.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13181TPR_8 2.80
PF13231PMT_2 1.87
PF13432TPR_16 1.87
PF13371TPR_9 1.87
PF13414TPR_11 0.93
PF00873ACR_tran 0.93
PF00326Peptidase_S9 0.93
PF13424TPR_12 0.93
PF03567Sulfotransfer_2 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02GYQD9All Organisms → cellular organisms → Bacteria546Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig811301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium889Open in IMG/M
2162886013|SwBSRL2_contig_797973All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101936409All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101938053All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300000953|JGI11615J12901_10474903All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300000955|JGI1027J12803_100354791All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium577Open in IMG/M
3300000955|JGI1027J12803_106560731All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300002077|JGI24744J21845_10050997All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005167|Ga0066672_10291571All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005171|Ga0066677_10735845All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005175|Ga0066673_10626732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium624Open in IMG/M
3300005175|Ga0066673_10854218All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium519Open in IMG/M
3300005179|Ga0066684_10807675All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005180|Ga0066685_10559314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium788Open in IMG/M
3300005187|Ga0066675_10493403All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005366|Ga0070659_100199649All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300005446|Ga0066686_10365596All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium985Open in IMG/M
3300005540|Ga0066697_10006745All Organisms → cellular organisms → Bacteria5701Open in IMG/M
3300005549|Ga0070704_101390956All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005554|Ga0066661_10105279All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300005555|Ga0066692_10016429All Organisms → cellular organisms → Bacteria3655Open in IMG/M
3300005556|Ga0066707_10995167All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium511Open in IMG/M
3300005576|Ga0066708_10041758All Organisms → cellular organisms → Bacteria2523Open in IMG/M
3300005586|Ga0066691_10210615All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300005614|Ga0068856_101751452All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005764|Ga0066903_103380131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium861Open in IMG/M
3300005764|Ga0066903_104416590All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300005842|Ga0068858_100488836All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300005843|Ga0068860_101674499All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300006031|Ga0066651_10520672All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300006032|Ga0066696_10056783All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300006032|Ga0066696_10394841All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300006755|Ga0079222_12098700All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006791|Ga0066653_10342976All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300006796|Ga0066665_11460409All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300006797|Ga0066659_10014342All Organisms → cellular organisms → Bacteria4369Open in IMG/M
3300006914|Ga0075436_101114297All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium594Open in IMG/M
3300006954|Ga0079219_11434802All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium619Open in IMG/M
3300009012|Ga0066710_100188404All Organisms → cellular organisms → Bacteria2921Open in IMG/M
3300009098|Ga0105245_10343382All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300009100|Ga0075418_12500231All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium564Open in IMG/M
3300009137|Ga0066709_103023919All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium617Open in IMG/M
3300009162|Ga0075423_12311539All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium585Open in IMG/M
3300009545|Ga0105237_11802238All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300010301|Ga0134070_10244274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium670Open in IMG/M
3300010326|Ga0134065_10034440All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300010359|Ga0126376_11002481All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium835Open in IMG/M
3300010361|Ga0126378_11130943All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium883Open in IMG/M
3300010361|Ga0126378_11406303All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium790Open in IMG/M
3300012096|Ga0137389_10418715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1145Open in IMG/M
3300012096|Ga0137389_10560908All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium981Open in IMG/M
3300012189|Ga0137388_11096186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium733Open in IMG/M
3300012198|Ga0137364_11142517All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012202|Ga0137363_10539559All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium982Open in IMG/M
3300012209|Ga0137379_10557113All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1054Open in IMG/M
3300012211|Ga0137377_11088389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium729Open in IMG/M
3300012211|Ga0137377_11811909All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012356|Ga0137371_11360286All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium523Open in IMG/M
3300012361|Ga0137360_10051620All Organisms → cellular organisms → Bacteria2965Open in IMG/M
3300012361|Ga0137360_10342908All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300012929|Ga0137404_10293031All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300012944|Ga0137410_11178867All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012958|Ga0164299_11371374All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012961|Ga0164302_10672610All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300012972|Ga0134077_10127232All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300012977|Ga0134087_10212129All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300013765|Ga0120172_1027024All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300014052|Ga0120109_1114400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300014157|Ga0134078_10033165All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300015357|Ga0134072_10016982All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300015372|Ga0132256_101606339All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300015374|Ga0132255_101443684All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300016270|Ga0182036_11298163All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium607Open in IMG/M
3300018027|Ga0184605_10000053All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia31755Open in IMG/M
3300018431|Ga0066655_10194892All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300018431|Ga0066655_11077912All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M
3300018433|Ga0066667_10047297All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300018433|Ga0066667_10074452All Organisms → cellular organisms → Bacteria2162Open in IMG/M
3300018468|Ga0066662_12842798All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300019868|Ga0193720_1060169All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300019881|Ga0193707_1091156All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium922Open in IMG/M
3300019886|Ga0193727_1108795All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300021080|Ga0210382_10285474All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium725Open in IMG/M
3300025910|Ga0207684_10515242All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300025914|Ga0207671_11106930All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300025925|Ga0207650_11300455All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300025960|Ga0207651_10244088All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300026035|Ga0207703_10481611All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300026095|Ga0207676_11180816All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300026121|Ga0207683_10525170All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300026142|Ga0207698_10546055All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300026300|Ga0209027_1026467All Organisms → cellular organisms → Bacteria2197Open in IMG/M
3300026300|Ga0209027_1086142All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300026308|Ga0209265_1040188All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300026315|Ga0209686_1052390All Organisms → cellular organisms → Bacteria1487Open in IMG/M
3300026326|Ga0209801_1063816All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300026327|Ga0209266_1173266All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300026327|Ga0209266_1182631All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300026523|Ga0209808_1048793All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300026538|Ga0209056_10199683All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300027748|Ga0209689_1007867All Organisms → cellular organisms → Bacteria7325Open in IMG/M
3300027875|Ga0209283_10469478All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium813Open in IMG/M
3300027909|Ga0209382_10365981All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300028875|Ga0307289_10362262All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031720|Ga0307469_10575616All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300032177|Ga0315276_10827067All Organisms → cellular organisms → Bacteria990Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil28.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_034080402065487018SoilYVVVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRNT
KansclcFeb2_034645302124908045SoilVYAIVLLALKTFSTEEIHHAREGIAFVYPFIESWAKKLKRNT
SwBSRL2_0433.000049302162886013Switchgrass RhizosphereGTPSIIARIGVAALAISAYIIVLFALKTFSSKELHQVREGIGFVSPFIESWTKKLRRDT
INPhiseqgaiiFebDRAFT_10193640913300000364SoilAPPLWQIGAAALSVIVYGVVLFALKTFSTEEIHHAREGIAFVSPFIESWAKKLKRNT*
INPhiseqgaiiFebDRAFT_10193805333300000364SoilALKTFSLEEAHQAREGLAFFSPFVASWSKKLKRGA*
JGI11615J12901_1047490313300000953SoilIVYGVVLFAFKTFTTEEIHHAREGIAFVSPFIESWSKKLKRGA*
JGI1027J12803_10035479123300000955SoilWQIVAGVVSLIAYVLVLLALKTFSMEEIYHAREGIAFVSPFIESWVKKLRRNT*
JGI1027J12803_10656073113300000955SoilLGAAGLAIVVYALMLLALKTFSAEEMRHAREGLAFFHPFVTSWAKKLKRNS*
JGI24744J21845_1005099723300002077Corn, Switchgrass And Miscanthus RhizosphereYALGLLLLRTFSEEEIQHAREGISFVSPFLASWAKKLRRNP*
Ga0066672_1029157123300005167SoilIVLLALKTFSVEEVRHAREGLAFFPPLVASWTKKLKRDS*
Ga0066677_1073584513300005171SoilMLALTVYVAVLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0066673_1062673223300005175SoilLLWAIPAAVLSVIVYAVVLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT*
Ga0066673_1085421823300005175SoilGLLWQLAAGVVSVIVYVVVLLALKTFSMEEIHHAREGIAFVSPFIESWTKKLKRNT*
Ga0066684_1080767513300005179SoilTAMLALTVYVAVLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0066685_1055931423300005180SoilVYALVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS*
Ga0066675_1049340313300005187SoilQLGAAALAVVVYALVLLALKTFSSEEVRHAREGLAFFSPFVASWAKKLKRDS*
Ga0070659_10019964913300005366Corn RhizosphereVGALSLLLYGVILIALKTFSIEEIRHAREGIAFVSPFIESWAKKLKGDT*
Ga0066686_1036559613300005446SoilGAVLSILSYGAVLFAVRTFSREEIHQAREGIAFVSPFVESWVKKLKRNT*
Ga0066697_1000674513300005540SoilVVVYALVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS*
Ga0070704_10139095613300005549Corn, Switchgrass And Miscanthus RhizosphereSLLLYGVILFALKTFSIEEIRHAREGIAFVSPFIESWAKKLKGDT*
Ga0066661_1010527933300005554SoilAAVVSIIVYALVLLALKTFSVEEIHHAREGIAFVSPFIESWVKKLKRNT*
Ga0066692_1001642913300005555SoilTVYVAVLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0066707_1099516723300005556SoilVVLLALKTFSMEEMHHAREGIAFVSPFIESWVKKLKRNT*
Ga0066708_1004175813300005576SoilVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS*
Ga0066691_1021061513300005586SoilALVLVALKTFSVEEVHHAREGLAFFSPFVASWAKKLKRNS*
Ga0068856_10175145223300005614Corn RhizosphereLVAYGILLLVLRTFSSEEVVQAREGLAFVSPFVASWAKKLRRNS*
Ga0066903_10338013113300005764Tropical Forest SoilAYGLVLLGLRTFSTEEIHHAREGIAFVYPFVESWAKKLRQNT*
Ga0066903_10441659013300005764Tropical Forest SoilGAVLSILIYGAVLFALRTFSREEIHQAREGIAFVSPFVESWVKKLKRNT*
Ga0068858_10048883613300005842Switchgrass RhizosphereVLLALRTFSSEEISQAREGIAFFSPFVASWAKKLRRDS*
Ga0068860_10167449923300005843Switchgrass RhizosphereVSYGAVLLALRTFSSEEISQAREGMAFVSPFVASWAKKLRRDS*
Ga0066651_1052067223300006031SoilLALVVYTIVLLALKTFSVEEVRHAREGLAFFPPLVASWTKKLKRDS*
Ga0066696_1005678313300006032SoilGSGGTLVWQIAAAVVSIIVYALVLLALKTFSVEEIHHAREGIAFVSPFIESWVKKLKRNT
Ga0066696_1039484113300006032SoilLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0079222_1209870013300006755Agricultural SoilIAGAALSVIAYGVVLFALRTFSNEEINQAREGIAFVSPFVASWAKKLRRDS*
Ga0066653_1034297613300006791SoilLGAAALAVVVYAAVLLALKTFSSEEVRHAREGLAFFSPFVASWAKKLKRDS*
Ga0066665_1146040923300006796SoilSILSYGAVLFAVRTFSREEIHQAREGIAFVSPFVESWVKKLKRNT*
Ga0066659_1001434213300006797SoilAVVSIIVYAVVLLALKTFSTEEIHHAREGIAFVYPFIESWAKKLKRNT*
Ga0075436_10111429723300006914Populus RhizosphereVSLIVYVAVLLALKTFSLEEIHHAREGIAFVSPFIESWAKKFKRNT*
Ga0079219_1143480223300006954Agricultural SoilYGLVLLGLRTFSTEEIDHAREGIAFVYPFVESWAKKLKHNA*
Ga0066710_10018840433300009012Grasslands SoilWQIGTAALSVIVYGVVLFALKTFSMEEMHHAREGIAFVSPFIESWTKKLKRNT
Ga0105245_1034338223300009098Miscanthus RhizosphereVILIALKTVSIEEIRDAREGIAFVSPFIESWAKKLKGDT*
Ga0075418_1250023123300009100Populus RhizosphereVLFAVRTFSREEIHQAREGIAFLSLFVESWAKKLKRNT*
Ga0066709_10302391923300009137Grasslands SoilGAAALSIVVYGIVLFALKTFSMEEIHHAREGIAFVSPFIESWAKKLKRNT*
Ga0075423_1231153923300009162Populus RhizosphereWRIPAAVVSLIVYVAVLLALKTFSLEEIHHAREGIAFVSPFIESWAKKFKRNT*
Ga0105237_1180223823300009545Corn RhizosphereLLLYGIILFALKTFSMEEIRHAREGIAFVSPFIESWAKKLKGDT*
Ga0134070_1024427423300010301Grasslands SoilGALSLLLYGVILFALKTFSIEEIRHAREGIAFFSPFVASWAKKLKGDT*
Ga0134065_1003444043300010326Grasslands SoilVLLAVKKFSGEEVRHAREGLAFFSPFVASWTKKLKRDS*
Ga0126376_1100248123300010359Tropical Forest SoilSILSYGAVLFAVRTFSREEIHQAREGIAFLSPFVESWAKKLKRNT*
Ga0126378_1113094323300010361Tropical Forest SoilYGAVLFALHTFSREEIHQARERIAFVSPFVESWVKKLKRNT*
Ga0126378_1140630313300010361Tropical Forest SoilAVLLALKTFSVEEIHHAREGIAFVSPFIESWAKKFKRNT*
Ga0137389_1041871513300012096Vadose Zone SoilGLALVVYGVVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS*
Ga0137389_1056090823300012096Vadose Zone SoilLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT*
Ga0137388_1109618623300012189Vadose Zone SoilAVLSVIVYALVLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT*
Ga0137364_1114251723300012198Vadose Zone SoilLFGLKTFSTEEIHHAREGIAFVSPFIESWAKKLKRNT*
Ga0137363_1053955913300012202Vadose Zone SoilVLFAVRTFSREEIHQAREGIAFVSPFVESWVKKLKRDT*
Ga0137379_1055711313300012209Vadose Zone SoilAAVLSVIVYALVLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT*
Ga0137377_1108838923300012211Vadose Zone SoilVLLGLKTFSMEEIHHAREGIAFVSPFIESWVKKLKRNT*
Ga0137377_1181190923300012211Vadose Zone SoilYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRNT*
Ga0137371_1136028613300012356Vadose Zone SoilLVLLALKTFSVEEIHHAREGIAFVSPFIESWVKKLKRNT*
Ga0137360_1005162033300012361Vadose Zone SoilSVIVYVVVLLALKTFSMEEIHHAREGIAFVSPFIESWTKKLKRNT*
Ga0137360_1034290813300012361Vadose Zone SoilVYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLRRNT*
Ga0137404_1029303113300012929Vadose Zone SoilILSYVAVLVAVRTFSREEIHQAREGIAFVTPFVESWVKKLKRNA*
Ga0137410_1117886723300012944Vadose Zone SoilYGAVLFALRTFSSEEISQAREGIAFVSPFVASWAKKLRRGS*
Ga0164299_1137137413300012958SoilLRTFSSEEISQAREGIAFFSHFVASWAKKLRRDS*
Ga0164302_1067261023300012961SoilGLLVLRTFSSEEIHQAREGMAFVSPFVASWAKKLRRNS*
Ga0134077_1012723213300012972Grasslands SoilLALTVYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0134087_1021212933300012977Grasslands SoilSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT*
Ga0120172_102702413300013765PermafrostVLLALKTFSIEEVRHAREGIAFFSPFVASWAEKLKRDS*
Ga0120109_111440013300014052PermafrostVLVYLATLFALRTFSQEEIYHAREGIGFISPFVASWAKKLKREES*
Ga0134078_1003316533300014157Grasslands SoilLLAIKTFSVEEVPHAREGLAFFSPFVASWAKKLKRDS*
Ga0134072_1001698233300015357Grasslands SoilQLGAAGLAVVVYALVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS*
Ga0132256_10160633923300015372Arabidopsis RhizosphereVLFALRTFSNEEINQAREGIAFVSPFVASWAKKLRRDS*
Ga0132255_10144368423300015374Arabidopsis RhizosphereLRTFSEEEIQHAREGISFVSPFLASWAKKLRRNP*
Ga0182036_1129816323300016270SoilLSILSYIAVLFAVRTFSREEIHQAREGIAFLSPFVESWVKKLKRNA
Ga0184605_10000053273300018027Groundwater SedimentALSVYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRNT
Ga0066655_1019489223300018431Grasslands SoilVVYALVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRDS
Ga0066655_1107791223300018431Grasslands SoilVVYALVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS
Ga0066667_1004729713300018433Grasslands SoilSVYIIVLFALKTFSSKELHHVREGMGFVSPFIESWTRKLRRDT
Ga0066667_1007445233300018433Grasslands SoilVLSILSYGAVLFAVRTFSREEIHQAREGVAFISPFVESWAKKLKRNT
Ga0066662_1284279823300018468Grasslands SoilAVLSVIVYALVLLGLKTFSMEEMHHAREGIAFVSPFIQSWAKKLKRNT
Ga0193720_106016913300019868SoilALRTFSSEEISQAREGIAFVSPFVASWAKKLRRGS
Ga0193707_109115623300019881SoilWQLVGAVLSILSYVAVLVAVRTFSREEIHQAREGIAFVSPFVESWVKKLKRNT
Ga0193727_110879513300019886SoilVYAIVLLALKTFSVEEVRHAREGLAFLPPFVASWTKKLKRDS
Ga0210382_1028547413300021080Groundwater SedimentLSILSYGAVLFAVRTFSREEIHQAREGIAFVSPFVESWAKKLKRNT
Ga0207684_1051524213300025910Corn, Switchgrass And Miscanthus RhizosphereLGAAGIAVVVYALVLVALKTFSVEEVHHAREGLAFFSPFVASWAKKLKRNS
Ga0207671_1110693013300025914Corn RhizosphereLLLYGIILFALKTFSMEEIRHAREGIAFVSPFIESWAKKLKGDT
Ga0207650_1130045513300025925Switchgrass RhizosphereVLLALRTFSSEEISQAREGIAFVSPFVASWAKKLRRDS
Ga0207651_1024408823300025960Switchgrass RhizosphereLLLLRTFSEEEIQHAREGISFVSPFLASWAKKLRRNP
Ga0207703_1048161123300026035Switchgrass RhizosphereGAVLLALRTFSSEEISQAREGIAFFSPFVASWAKKLRRDS
Ga0207676_1118081623300026095Switchgrass RhizosphereAVLLALRTFSSEEISQAREGMAFVSPFVASWAKKLRRDS
Ga0207683_1052517013300026121Miscanthus RhizosphereLLRTFSTEEIQQAREGIAFVSPFVASWAKKLRRDP
Ga0207698_1054605513300026142Corn RhizosphereALKTFSIEEIRHAREGIAFVSPFIESWAKKLKGDT
Ga0209027_102646713300026300Grasslands SoilAVVVYALVLLALKTFSSEEVRHAREGLAFFSPFVASWAKKLKRDS
Ga0209027_108614223300026300Grasslands SoilVYVAVLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT
Ga0209265_104018823300026308SoilVYAVVLLALKTFSMEEMHHAREGIAFVSPFIESWAKKLKRNT
Ga0209686_105239023300026315SoilIGTAMLALTVYVAVLFSLRTFSIEEIRHAREGLGFLSPFVESWTKKLKRHT
Ga0209801_106381613300026326SoilAYLLVLFALRTFSSKEIHHVREGIGFVSPFIESWTKKLRGDT
Ga0209266_117326623300026327SoilQICTAILALTVYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRNT
Ga0209266_118263123300026327SoilGTAILALIVYVAVLFALRTFSIDEIRHAREGLGFLSPFVESWTKKLKRHT
Ga0209808_104879313300026523SoilVLLALKTFSVEEVRHAREGLAFFSPFVASWAKKLKRNS
Ga0209056_1019968323300026538SoilVVYALVLLALKPFSVEEVRHAREGLAFFSPFVASWAKKLKRN
Ga0209689_100786763300027748SoilPAAVVSIIVYAVVLLALKTFSTEEIHHAREGIAFVYPFIESWAKKLKRNT
Ga0209283_1046947813300027875Vadose Zone SoilLLAFKTFSMEEIHHAREGIAFVSPFIESWAKKLKRNT
Ga0209382_1036598113300027909Populus RhizosphereTGAALSVLSYGAVLLALRTFSSEEISQAREGIAFVSPFVASWAKKLRRDS
Ga0307289_1036226223300028875SoilPWQIGTAILALSVYVAVLFALRTFSIEEIRHAREGLGFLSPFVESWTKKLKRNT
Ga0307469_1057561613300031720Hardwood Forest SoilAALSVIVYGVVLFALKTFSTEEIYHAREGMAFVSPFVESWSKKLKRGA
Ga0315276_1082706713300032177SedimentSLVVYGLGLFLLRTFSNEEIRLAREGITFVSPFVASWAKKLRRGS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.