NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091914

Metagenome / Metatranscriptome Family F091914

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091914
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 87 residues
Representative Sequence MSALDCLGGSGVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Number of Associated Samples 89
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 10.28 %
% of genes near scaffold ends (potentially truncated) 71.96 %
% of genes from short scaffolds (< 2000 bps) 89.72 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (97.196 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(14.019 % of family members)
Environment Ontology (ENVO) Unclassified
(51.402 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.140 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.24%    β-sheet: 9.40%    Coil/Unstructured: 74.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00356LacI 63.55
PF03237Terminase_6N 7.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109120267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300003499|JGI25930J51415_1012557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1674Open in IMG/M
3300005528|Ga0068872_10746031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300005581|Ga0049081_10075603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1265Open in IMG/M
3300005582|Ga0049080_10050664All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1435Open in IMG/M
3300005758|Ga0078117_1104776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3666Open in IMG/M
3300006641|Ga0075471_10161930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1179Open in IMG/M
3300006917|Ga0075472_10383273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300007544|Ga0102861_1002828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3830Open in IMG/M
3300007590|Ga0102917_1303309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300007593|Ga0102918_1144344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300007622|Ga0102863_1095596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300007661|Ga0102866_1036451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1188Open in IMG/M
3300007670|Ga0102862_1035654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1187Open in IMG/M
3300007670|Ga0102862_1035751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1185Open in IMG/M
3300007716|Ga0102867_1099702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300007972|Ga0105745_1099465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300007974|Ga0105747_1039602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1361Open in IMG/M
3300008055|Ga0108970_11492559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300008266|Ga0114363_1081177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1209Open in IMG/M
3300008267|Ga0114364_1067090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1221Open in IMG/M
3300008448|Ga0114876_1176398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300008448|Ga0114876_1223716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300008448|Ga0114876_1225054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300008448|Ga0114876_1239172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300008450|Ga0114880_1159246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300009026|Ga0102829_1110317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300009057|Ga0102892_1087130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300009086|Ga0102812_10078602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1818Open in IMG/M
3300009158|Ga0114977_10115617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1620Open in IMG/M
3300009159|Ga0114978_10009763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7435Open in IMG/M
3300009159|Ga0114978_10236238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1141Open in IMG/M
3300009163|Ga0114970_10015487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5236Open in IMG/M
3300009168|Ga0105104_10419207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300009180|Ga0114979_10112872All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300009183|Ga0114974_10244680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300009184|Ga0114976_10231493All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300009185|Ga0114971_10291719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage945Open in IMG/M
3300010309|Ga0102890_1103891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300010354|Ga0129333_10770072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300010354|Ga0129333_11459196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300010885|Ga0133913_11914221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1478Open in IMG/M
3300010885|Ga0133913_12685369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1205Open in IMG/M
3300010885|Ga0133913_13133561All Organisms → Viruses → Predicted Viral1096Open in IMG/M
3300012717|Ga0157609_1020500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
(restricted) 3300013127|Ga0172365_10577381All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300013372|Ga0177922_10138528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300013372|Ga0177922_10182270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1980Open in IMG/M
3300013372|Ga0177922_10885310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1203Open in IMG/M
3300013372|Ga0177922_11314680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300017723|Ga0181362_1124854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300017754|Ga0181344_1051005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1234Open in IMG/M
3300017754|Ga0181344_1091121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300017777|Ga0181357_1188606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300017780|Ga0181346_1182278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300017784|Ga0181348_1269921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300017784|Ga0181348_1311474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300017785|Ga0181355_1395727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300019784|Ga0181359_1094106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1107Open in IMG/M
3300020162|Ga0211735_10437945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1448Open in IMG/M
3300020176|Ga0181556_1212540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage727Open in IMG/M
3300020179|Ga0194134_10113361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1299Open in IMG/M
3300020190|Ga0194118_10069141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2245Open in IMG/M
3300020204|Ga0194116_10161597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1327Open in IMG/M
3300020205|Ga0211731_10263567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300020205|Ga0211731_10475732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage926Open in IMG/M
3300020556|Ga0208486_1007750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1719Open in IMG/M
3300020578|Ga0194129_10118507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1763Open in IMG/M
3300022190|Ga0181354_1053184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1347Open in IMG/M
3300022190|Ga0181354_1143009All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300022752|Ga0214917_10168403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1128Open in IMG/M
3300025445|Ga0208424_1015962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300025848|Ga0208005_1162481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300025872|Ga0208783_10124000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1114Open in IMG/M
3300027138|Ga0255064_1015297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300027140|Ga0255080_1035363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300027153|Ga0255083_1056346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300027210|Ga0208802_1012234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1167Open in IMG/M
3300027393|Ga0209867_1054379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300027600|Ga0255117_1071003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300027721|Ga0209492_1187199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300027736|Ga0209190_1011107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5361Open in IMG/M
3300027763|Ga0209088_10085366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1470Open in IMG/M
3300027782|Ga0209500_10004814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8872Open in IMG/M
3300027798|Ga0209353_10219637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300027814|Ga0209742_10196683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300027816|Ga0209990_10416624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300029930|Ga0119944_1042462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300031758|Ga0315907_10689976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300031784|Ga0315899_11127765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300031787|Ga0315900_10181951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1891Open in IMG/M
3300031787|Ga0315900_10268509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1441Open in IMG/M
3300031787|Ga0315900_10597597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300031857|Ga0315909_10085407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2769Open in IMG/M
3300031885|Ga0315285_10503872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300032116|Ga0315903_10093271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2897Open in IMG/M
3300032156|Ga0315295_10620397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1095Open in IMG/M
3300033995|Ga0335003_0328393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300034021|Ga0335004_0537389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300034023|Ga0335021_0402508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300034061|Ga0334987_0169559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1573Open in IMG/M
3300034106|Ga0335036_0089167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2282Open in IMG/M
3300034107|Ga0335037_0012163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4590Open in IMG/M
3300034116|Ga0335068_0172313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1154Open in IMG/M
3300034120|Ga0335056_0608974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300034200|Ga0335065_0250493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1135Open in IMG/M
3300034200|Ga0335065_0714000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake13.08%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.54%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.74%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.87%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.87%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.87%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.93%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.93%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.93%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.93%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027140Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027210Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10912026713300002408FreshwaterRKCLLATLDALEGSGVQSQYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG*
JGI25930J51415_101255713300003499Freshwater LakeLLTTLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVKMTLAGVKHYSMKPKKQLNHWGEFPYSFKPYAG*
Ga0068872_1074603123300005528Freshwater LakeSGVQNPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPQKQLNHWGEFPYSFAPYAG*
Ga0049081_1007560333300005581Freshwater LenticWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0049080_1005066413300005582Freshwater LenticTLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0078117_110477613300005758Lake WaterLAIPRKCLMATLEGLGGSGVQMPYRIDWCDDVRVEQFPTLWMPLAVESMPGKLEYLSEDYAAAVRMSLCDVKHYSMKPKKQLNHWGEFPYSFAPYAG*
Ga0075471_1016193033300006641AqueousDWCVDTRVEKFPTLWMPFAMDTMPGQPEYLSEDYAAAVRLSLAGVQHYSMKPQKQLNHWGEYPYSFKPYAG*
Ga0075472_1038327313300006917AqueousMSALDELGGSEVQTPYKVDWCVDTRVEKFPTLWMPFAMDTMPGQPEYLSEDYAAAVRLSLAGVQHYSMKPQKQLNHWGEYPYSFKPYAG*
Ga0102861_100282813300007544EstuarineEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFAMMPKKQLNHWGEYPFSFKPYAG*
Ga0102917_130330923300007590EstuarineVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0102918_114434423300007593EstuarineVPITMFASGCLAIPRKCLIATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0102863_109559613300007622EstuarineTPYKIDWCVDTRVEKFPTLWMPFAMDTLPGQPEYLSEDYAAAVRLSLTGVQHYSMKPRKPLNHWGEYPYSFKPYAG*
Ga0102866_103645123300007661EstuarineTMFASGCLAIPRKCLIATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0102862_103565433300007670EstuarineMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLCEVKHYAMHPKKHLNHWGEYPYGFKPYVG*
Ga0102862_103575123300007670EstuarineEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0102867_109970223300007716EstuarinePITMFASGCLAIPRKCLIATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0105745_109946523300007972Estuary WaterMATLDALAGSGVQYPYKVDWCEDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0105747_103960223300007974Estuary WaterMSALDELGGSEVQTPYKVDWCKDVRVDEFPTLWMPFAVDTIPGQFEYLSEDYAAAMRLSLAGVQHYSMKPRKPLNHWGEYPYSFKPYAG*
Ga0108970_1149255913300008055EstuaryMSALDELGGSEVQTPYKVDWCVDTRVEKFPTLWMPFAMDTLPGQPEYLSEDYAAAVRLSLSGVQHYSMKPRKPLNHWGEYPYSFKPYAG*
Ga0114363_108117713300008266Freshwater, PlanktonRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114364_106709033300008267Freshwater, PlanktonVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114876_117639823300008448Freshwater LakeMFASGCLAIPRKCLIATLDALGGSGVQNPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPQKQLNHWGEFPYSFAPYAG*
Ga0114876_122371623300008448Freshwater LakeVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRLTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114876_122505413300008448Freshwater LakeMSALDCLGGSGVQNPHRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114876_123917223300008448Freshwater LakeMATLDALGGSGVQNPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPQKQLNHWGEFPYSFAPYAG*
Ga0114880_115924613300008450Freshwater LakeAIPRKCLLATLDALEGSGVQNPYRIDWCEDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0102829_111031723300009026EstuarineLETLGSVKVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQLNHWGEYPFSFKPYAG*
Ga0102892_108713013300009057EstuarineKCLIATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0102812_1007860213300009086EstuarineATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0114977_1011561733300009158Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0114978_1000976313300009159Freshwater LakeGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114978_1023623833300009159Freshwater LakeLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHLSMKPKKQLNHWGEFPFSFAPYAG*
Ga0114970_1001548713300009163Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTLPGQHEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYAG*
Ga0105104_1041920723300009168Freshwater SedimentATLDALEGSGVQSPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG*
Ga0114979_1011287213300009180Freshwater LakeVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCEVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0114974_1024468013300009183Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTLPGQHEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0114976_1023149323300009184Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0114971_1029171913300009185Freshwater LakeYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0102890_110389113300010309EstuarineLAIPRKCLIATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFVMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG*
Ga0129333_1077007223300010354Freshwater To Marine Saline GradientPYRIDWCKDVAVPEFPTLWMPFAFETLPGQPEYLSEDYAAALRLSLCDVPHYAYKPTKQLNHWGEYPYGFKGYAG*
Ga0129333_1145919623300010354Freshwater To Marine Saline GradientLGGSGVQMPYRIDWCDDVRVDRFPTLWMPIAMDSMPGKLEYLSEDYAAAVRMTLAGVNHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0133913_1191422123300010885Freshwater LakeMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTLPGQHEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0133913_1268536913300010885Freshwater LakeTLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHLSMKPKKQLNHWGEFPFSFAPYAG*
Ga0133913_1313356113300010885Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCEVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0157609_102050023300012717FreshwaterDALEGSGVQSPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG*
(restricted) Ga0172365_1057738113300013127SedimentSGQPMPYRIDWCADVRVEEFPTLWMPMAMESMPGKLEYLSEDFAAAARMTLAGVQHYSMRPSKQLNHWGEFPYSFAPYAG*
Ga0177922_1013852813300013372FreshwaterPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG*
Ga0177922_1018227033300013372FreshwaterMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTLPGQYEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG*
Ga0177922_1088531023300013372FreshwaterMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTQPGQLEYLSEDYAAAVRLSLAGVEHYSMLPKKPINHWGEYPFSFKPYAG*
Ga0177922_1131468013300013372FreshwaterSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKSKKQLNHWGEFPFSFAPYAG*
Ga0181362_112485413300017723Freshwater LakePRKRLIETLETLGSVKVLPPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQLNHWGEYPFSFKPYAG
Ga0181344_105100513300017754Freshwater LakeASGCLAIPRRCLMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG
Ga0181344_109112113300017754Freshwater LakeRCLMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCEVKHYAMHPKKHLNHWGEYPYGFKPYVG
Ga0181357_118860613300017777Freshwater LakeSVKVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQINHWGEYPFSFKPYAG
Ga0181346_118227823300017780Freshwater LakeLTTLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0181348_126992113300017784Freshwater LakeGSVKVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQLNHWGEYPFSFKPYAG
Ga0181348_131147413300017784Freshwater LakeKVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQLNHWGEYPFSFKPYAG
Ga0181355_139572713300017785Freshwater LakeGSVKVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQINHWGEYPFSFKPYAG
Ga0181359_109410623300019784Freshwater LakePYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0211735_1043794513300020162FreshwaterLDTLGGSTVQRPYKIDWCEDVKVERFPTLWMPLAMESLPGKLEYLSEDYAASVRMSLCDVKHFSMKPKKQLNHWGEYPFSFAPYAG
Ga0181556_121254023300020176Salt MarshAIPRKCLMATLEALEGSGVQNPYKIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMSLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG
Ga0194134_1011336133300020179Freshwater LakeASGCLAVPRKCLMATLDALGGSGQPMPYRIDWCADVRVEEFPTLWMPMAMESMPGKLEYLSEDFAAAARMTLAGVQHYSMKPSKQLNHWGEFPYSFAPYAG
Ga0194118_1006914113300020190Freshwater LakeMPYRIDWCADVRVEEFPTLWMPMAMESMPGKLEYLSEDFAAAARMTLAGVQHYSMKPSKQLHHWGEFPYSFAPYAG
Ga0194116_1016159733300020204Freshwater LakeLGGSGQPMPYRIDWCADVRVEEFPTLWMPMAMESMPGKLEYLSEDFAAAARMTLAGVQHYSMKPSKQLHHWGEFPYSFAPYAG
Ga0211731_1026356713300020205FreshwaterPNPFRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLFDVKHYAMHPKKHLNHWGEYPYGFKPYVG
Ga0211731_1047573213300020205FreshwaterSGCLAIPRRCLMSALDSLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLFDVKHYAMHPKKHLNHWGEYPYGFKPYVG
Ga0208486_100775013300020556FreshwaterMFASGCLAIPRRCLMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTLPGQHEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG
Ga0194129_1011850713300020578Freshwater LakeASGCLAVPRKCLMATLDALGGSGQPMPYRIDWCADVRVEEFPTLWMPMAMESMPGKLEYLSEDFAAAARMTLAGVQHYSMKPSKQLHHWGEFPYSFAPYAG
Ga0181354_105318433300022190Freshwater LakeGMFASGCLAIPRKCLLATLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0181354_114300913300022190Freshwater LakeITMFASGCLAIPRKCLMATLDALAGSGVQYPYKVDWCEDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAVRMTLAGVQHFAMKPKMQLNHWGEYPYSFKPYAG
Ga0214917_1016840313300022752FreshwaterARVDIAPPYRIDWCKDVRVEEFPTLWMPFAVDTMPGQLEYLSEDFAAAFRMSLCEVPHYSMMPKKQLNHWGEFPYSFAPYAG
Ga0208424_101596213300025445AqueousVETLEKLGRVDIAPPYRIDWCKDVRVEEFPTLWMPFAVDTMPGQLEYLSEDFAAAFRMSLCEVPHYSMMPKKQLNHWGEFPYSFAPYAG
Ga0208005_116248123300025848AqueousMSALDELGGSEVQTPYKVDWCVDTRVEKFPTLWMPFAMDTMPGQPEYLSEDYAAAVRLSLAGVQHYSMKPQKQLNHWGEYPYSFKPYAG
Ga0208783_1012400023300025872AqueousDWCVDTRVEKFPTLWMPFAMDTMPGQPEYLSEDYAAAVRLSLAGVQHYSMKPQKQLNHWGEYPYSFKPYAG
Ga0255064_101529733300027138FreshwaterMFASGCLAIPRKCLMATLDALAGSGVQYPYKVDWCEDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAVRMTLAGVQHFAMKPRKQLNHWGEYPYSFKPYAG
Ga0255080_103536323300027140FreshwaterYRIDWCDDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAVRMTLAGVQHFAMKPKMQLNHWGEYPYSFKPYAG
Ga0255083_105634623300027153FreshwaterTMFASGCLAIPRKCLLATLDALGGSGVQYPYRIDWCDDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAVRMTLAGVQHFAMKPKMQLNHWGEYPYSFKPYAG
Ga0208802_101223423300027210EstuarineLLATLEMMEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0209867_105437923300027393SandASGCLAIPRKCLVATLDALGGSGVQYPYKIDWCDDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAARMTLAGVQHFSMKPKMQLNHWGEYPYSFKPYAG
Ga0255117_107100313300027600FreshwaterIAPPYRIDWCKDVRVEEFPTLWMPFAVDTMPGQLEYLSEDFAAAFRMSLCEVPHYSMMPKKQLNHWGEFPYSFAPYAG
Ga0209492_118719923300027721Freshwater SedimentEMLEGSAVQSPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG
Ga0209190_101110713300027736Freshwater LakeMSALDWLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDSRPGEYEYLSEDYAAAVRLSLCEVKHYAMHPKKHLNHWGEYPYGFKPYVG
Ga0209088_1008536643300027763Freshwater LakeVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCEVKHYAMQPKKHLNHWGEYPYGFKPYVG
Ga0209500_10004814113300027782Freshwater LakeATLEMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0209353_1021963723300027798Freshwater LakeVLHPYRIEWCKDVKVGEFPTLWLPMAVETLPGQLEYLSEDFAAAMRMSLCEVPHFSMMPKKQLNHWGEYPFSFKPYAG
Ga0209742_1019668323300027814Marine SedimentLVETLEKLGRVDIAPPYRIDWCKDVRVEEFPTLWMPFAVDTMPGQLEYLSEDFAAAFRMSLCEVPHYSMMPKKQLNHWGEFPYSFAPYAG
Ga0209990_1041662423300027816Freshwater LakeCLGGSGVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRLTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0119944_104246223300029930AquaticSGCLAIARGSLIGALSKLGGSGVQTPYKIDWCKDVVVSEFPTLWMPFAFETMPGQPEYLSEDYAAALRLSLCDVQHYAYKPTKQLNHWGEYPYGFKGNAG
Ga0315907_1068997613300031758FreshwaterRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPYSFKPYAG
Ga0315899_1112776523300031784FreshwaterTRKCLLATLDALEGSGVQNPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPYSFKPYAG
Ga0315900_1018195113300031787FreshwaterMSALDCLGGSGVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0315900_1026850913300031787FreshwaterDYPYRIDWCKDTLAGEFPTLWMPFAVDTLPNQLEYLSEDYAAAFRLSLCEVEHLAYRPSKPLSHWGEFPFAFHAYAPR
Ga0315900_1059759713300031787FreshwaterVPITMFASGCLAIPRKCLMATLDALGGSGVQYPYKVDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPYSFKPYAG
Ga0315909_1008540733300031857FreshwaterVQTPYRIDWCKDVAVPEFPTLWMPFAFETLPGQPEYLSEDYAAALRLSLCDVPHYAYRPTKQLNHWGEYPYGFKGYGG
Ga0315285_1050387223300031885SedimentSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTQPGQMEYLSEDYAAAVRLSLAGVEHYSMLPKKPINHWGEYPFSFKPYAG
Ga0315903_1009327113300032116FreshwaterMSALDCLGGSGVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRLTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0315295_1062039723300032156SedimentALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTQPGQLEYLSEDYAAAVRLSLAGVEHYSMLPKKPINHWGEYPFSFKPYAG
Ga0335003_0328393_97_3663300033995FreshwaterMSALDSLGGLEVPHPYRIDWCKDTRVDQFPTLWMPFAMDSASGDYEYLSEDYAAAVRLSLFDVKHYAMHPKKHLNHWGEYPYGFKPYVG
Ga0335004_0537389_188_4993300034021FreshwaterMFASGCLAIPRKCLLATLDALEGSGVQSPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG
Ga0335021_0402508_227_5383300034023FreshwaterMFASGCLAIPRKCLIATLDALAGSGVQYPYKVDWCEDVRVERFPTLWMPFAMESRPGKLEYLSEDYAAAVRMTLAGVQHFAMKPKMQLNHWGEYPYSFKPYAG
Ga0334987_0169559_259_5283300034061FreshwaterMSALDTLGGSEVPNPYRIDWCKDVRVDQFPTLWMPFAMDTKPGDYEYLSEDYAAAVRLSLCDVKHYAMQPKKHLNHWGEYPYGFKPYVG
Ga0335036_0089167_42_3533300034106FreshwaterMFASGCLAIPRKCLLATLDALEGSGVQSQYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG
Ga0335037_0012163_4318_45723300034107FreshwaterMLEGSAVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVQHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0335068_0172313_3_2753300034116FreshwaterLLATLDALEGSGVQSPYRIDWCEDVRVERFPTLWMPLTMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG
Ga0335056_0608974_282_5183300034120FreshwaterVQNPYRIDWCDDVRVERFPTLWMPFAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0335065_0250493_880_11163300034200FreshwaterVQNPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHYSMKPKKQLNHWGEFPFSFAPYAG
Ga0335065_0714000_341_5713300034200FreshwaterSPYRIDWCEDVRVERFPTLWMPLAMESMPGKLEYLSEDYAAAVRMTLAGVKHLSMKPRKQLNHWGEFPFSFAPYAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.