Basic Information | |
---|---|
Family ID | F092011 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 47 residues |
Representative Sequence | MDTPDDVFHTAVLVIGVLGILVSLAGIAFWWVSRKMNRLT |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 30.84 % |
% of genes near scaffold ends (potentially truncated) | 28.04 % |
% of genes from short scaffolds (< 2000 bps) | 80.37 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.981 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (11.215 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.710 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.925 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF09343 | DUF2460 | 35.51 |
PF00561 | Abhydrolase_1 | 14.02 |
PF12697 | Abhydrolase_6 | 11.21 |
PF01053 | Cys_Met_Meta_PP | 8.41 |
PF09931 | DUF2163 | 1.87 |
PF06199 | Phage_tail_2 | 1.87 |
PF00072 | Response_reg | 0.93 |
PF09550 | Phage_TAC_6 | 0.93 |
PF00775 | Dioxygenase_C | 0.93 |
PF11836 | Phage_TAC_11 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 8.41 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 8.41 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 8.41 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 8.41 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 8.41 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 8.41 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 8.41 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 8.41 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 8.41 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 8.41 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 8.41 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.98 % |
Unclassified | root | N/A | 14.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886007|SwRhRL2b_contig_2440282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 930 | Open in IMG/M |
2228664021|ICCgaii200_c0868665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
3300000881|JGI10215J12807_1076701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1684 | Open in IMG/M |
3300004114|Ga0062593_100172725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 1678 | Open in IMG/M |
3300004156|Ga0062589_100239452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1350 | Open in IMG/M |
3300004156|Ga0062589_100265140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1299 | Open in IMG/M |
3300004156|Ga0062589_100374439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
3300004156|Ga0062589_102911054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300004157|Ga0062590_101099171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 766 | Open in IMG/M |
3300004157|Ga0062590_102694281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300004463|Ga0063356_105842174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 528 | Open in IMG/M |
3300004480|Ga0062592_101830778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 595 | Open in IMG/M |
3300004643|Ga0062591_100998643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
3300005164|Ga0066815_10006776 | Not Available | 1305 | Open in IMG/M |
3300005168|Ga0066809_10152241 | Not Available | 601 | Open in IMG/M |
3300005290|Ga0065712_10001175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8151 | Open in IMG/M |
3300005332|Ga0066388_100238809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2453 | Open in IMG/M |
3300005332|Ga0066388_101190036 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300005332|Ga0066388_108462784 | Not Available | 512 | Open in IMG/M |
3300005366|Ga0070659_100692178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 881 | Open in IMG/M |
3300005367|Ga0070667_100856612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
3300005438|Ga0070701_10068834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
3300005440|Ga0070705_100083106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 1972 | Open in IMG/M |
3300005445|Ga0070708_100392270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1309 | Open in IMG/M |
3300005455|Ga0070663_101847128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300005458|Ga0070681_10409869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1267 | Open in IMG/M |
3300005530|Ga0070679_100018605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6744 | Open in IMG/M |
3300005535|Ga0070684_100156757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2065 | Open in IMG/M |
3300005545|Ga0070695_100567125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
3300005713|Ga0066905_100020952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3476 | Open in IMG/M |
3300005713|Ga0066905_101436727 | Not Available | 626 | Open in IMG/M |
3300005713|Ga0066905_101476412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
3300005713|Ga0066905_101929092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
3300005842|Ga0068858_100287641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1566 | Open in IMG/M |
3300005937|Ga0081455_10005892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13312 | Open in IMG/M |
3300006573|Ga0074055_11738252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300006577|Ga0074050_12042407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
3300006580|Ga0074049_13191423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
3300006581|Ga0074048_10046678 | Not Available | 1095 | Open in IMG/M |
3300006581|Ga0074048_13353110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 570 | Open in IMG/M |
3300006755|Ga0079222_11072335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 703 | Open in IMG/M |
3300006854|Ga0075425_100241958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2076 | Open in IMG/M |
3300006854|Ga0075425_100652234 | Not Available | 1210 | Open in IMG/M |
3300006914|Ga0075436_100754689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 723 | Open in IMG/M |
3300009094|Ga0111539_11107518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300009174|Ga0105241_12377063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
3300009176|Ga0105242_10595714 | Not Available | 1067 | Open in IMG/M |
3300009553|Ga0105249_11266324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 809 | Open in IMG/M |
3300010047|Ga0126382_10206941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1401 | Open in IMG/M |
3300010360|Ga0126372_12100259 | Not Available | 613 | Open in IMG/M |
3300010362|Ga0126377_10744960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1035 | Open in IMG/M |
3300010371|Ga0134125_11505524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 733 | Open in IMG/M |
3300010373|Ga0134128_10760254 | Not Available | 1075 | Open in IMG/M |
3300010375|Ga0105239_12321441 | Not Available | 624 | Open in IMG/M |
3300010400|Ga0134122_11813150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
3300010403|Ga0134123_12052294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
3300012485|Ga0157325_1000932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
3300012908|Ga0157286_10072180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300012958|Ga0164299_10028622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2392 | Open in IMG/M |
3300012960|Ga0164301_10003243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5657 | Open in IMG/M |
3300013297|Ga0157378_11427153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 736 | Open in IMG/M |
3300013307|Ga0157372_10622266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1258 | Open in IMG/M |
3300014745|Ga0157377_10875498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
3300014969|Ga0157376_11493424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
3300015201|Ga0173478_10009490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2474 | Open in IMG/M |
3300015371|Ga0132258_13020589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
3300015374|Ga0132255_105539873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300019356|Ga0173481_10001014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6530 | Open in IMG/M |
3300019361|Ga0173482_10000091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12759 | Open in IMG/M |
3300019362|Ga0173479_10146064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 939 | Open in IMG/M |
3300022880|Ga0247792_1000959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4699 | Open in IMG/M |
3300022892|Ga0247753_1036586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
3300023073|Ga0247744_1014717 | Not Available | 1078 | Open in IMG/M |
3300023263|Ga0247800_1002590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2734 | Open in IMG/M |
3300025911|Ga0207654_11042221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
3300025912|Ga0207707_11397075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
3300025919|Ga0207657_10839446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
3300025921|Ga0207652_10808785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
3300025924|Ga0207694_11521623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300025930|Ga0207701_11081679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
3300025941|Ga0207711_11515253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
3300025981|Ga0207640_10087564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2147 | Open in IMG/M |
3300025981|Ga0207640_11605861 | Not Available | 586 | Open in IMG/M |
3300025986|Ga0207658_10799388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
3300026779|Ga0207471_101910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 736 | Open in IMG/M |
3300026853|Ga0207443_1002229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 910 | Open in IMG/M |
3300027252|Ga0209973_1058733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
3300027453|Ga0207624_106077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 671 | Open in IMG/M |
3300027617|Ga0210002_1012748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1308 | Open in IMG/M |
3300027682|Ga0209971_1058938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
3300027876|Ga0209974_10012219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2874 | Open in IMG/M |
3300027876|Ga0209974_10077396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
3300027907|Ga0207428_10515403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 867 | Open in IMG/M |
3300028381|Ga0268264_12293052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1002895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3243 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10001951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5295 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10017475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1842 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1004761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3239 | Open in IMG/M |
3300031716|Ga0310813_10021398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4422 | Open in IMG/M |
3300031908|Ga0310900_11422043 | Not Available | 583 | Open in IMG/M |
3300032013|Ga0310906_10094601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1622 | Open in IMG/M |
3300032144|Ga0315910_10992906 | Not Available | 655 | Open in IMG/M |
3300032180|Ga0307471_101264387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
3300032205|Ga0307472_100100670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1987 | Open in IMG/M |
3300032205|Ga0307472_101255494 | Not Available | 711 | Open in IMG/M |
3300032205|Ga0307472_102627735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
3300033004|Ga0335084_10294809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1677 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 11.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.54% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 5.61% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 3.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Host-Associated | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026779 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-11 (SPAdes) | Environmental | Open in IMG/M |
3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027453 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL2b_0599.00001110 | 2162886007 | Switchgrass Rhizosphere | MDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT |
ICCgaii200_08686652 | 2228664021 | Soil | MDYLLENNSEPVPVHCRFGGMDAPEILXHTVVLXVAVLGILISLAGIAFWWVSRKMNRLT |
JGI10215J12807_10767013 | 3300000881 | Soil | SDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0062593_1001727252 | 3300004114 | Soil | VEWSHRLPFDNNSEPVPVHCRFGGMDAPEILIHTVVLAIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0062589_1002394522 | 3300004156 | Soil | MPAQCRFGGMDAPDAILHIALLVVGVLGILISLAGIVFWWVSRKMNRLT* |
Ga0062589_1002651402 | 3300004156 | Soil | MSSAEIAIHTAILVVAVLGILIALAGIAFWWVSRKMNRLT* |
Ga0062589_1003744393 | 3300004156 | Soil | MSRITFLNRKSEPAAVHCRFGGMDAPEILIHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0062589_1029110541 | 3300004156 | Soil | MPDHCRFGGMDALHATVHTAVLVLAVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0062590_1010991712 | 3300004157 | Soil | HCRFGGMDAPEILIHTVVLAIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0062590_1026942812 | 3300004157 | Soil | MDAPEILIHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0063356_1058421742 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRITFLNRRSEPVPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0062592_1018307782 | 3300004480 | Soil | MDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0062591_1009986432 | 3300004643 | Soil | VEWSHRLPFDNNSEPVPVHCRFGGMDAPEILIHTVVVAITVLGILISLAGIAFWWVSRKMNRLT* |
Ga0066815_100067761 | 3300005164 | Soil | MDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0066809_101522412 | 3300005168 | Soil | MRAEPAPVHCRFGGMDTPDALVHTAVLVIGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0065712_100011758 | 3300005290 | Miscanthus Rhizosphere | MDASDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0066388_1002388094 | 3300005332 | Tropical Forest Soil | MDYLFAQNGEPARPHDRFAAMSEPETVLHIAILVIAVLGILISLAGIAFWWVSRKMGRLT |
Ga0066388_1011900362 | 3300005332 | Tropical Forest Soil | MAGPEPLWVHCSFATMSLEEITIHIVILVVAVLGILIALAGIAFWWVSRKMKRLT* |
Ga0066388_1084627842 | 3300005332 | Tropical Forest Soil | MDEPEIVFHTAILVIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0070659_1006921782 | 3300005366 | Corn Rhizosphere | YLLQLRWELMPAQCRFGGMDAPDAILHIALLVVGVLGILISLAGIVFWWVSRKMNRLT* |
Ga0070667_1008566122 | 3300005367 | Switchgrass Rhizosphere | MPAQCRFGGMDAPDAILHIALLVVGVLAILISLAGIVFWWVSRKMNRLT* |
Ga0070701_100688342 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTSDAVFHIAVLVIGVLGILLSLAGITFWWASRKMNRLT* |
Ga0070705_1000831061 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPEILIHTVVVAITVLGILISLAGIAFWWVSRKMNRLT* |
Ga0070708_1003922703 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SEPVPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0070663_1018471281 | 3300005455 | Corn Rhizosphere | MPDHCRFGGMDALHATVHTAVLVIAVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0070681_104098694 | 3300005458 | Corn Rhizosphere | VEWSHRLPFDNNSEPVPVHCRFGGMDAPEILIHTVVVAITVLGILISLAGIAFW |
Ga0070679_1000186053 | 3300005530 | Corn Rhizosphere | VPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0070684_1001567572 | 3300005535 | Corn Rhizosphere | MDASDAVFHIAVLVIGVLGILLSLAGITFWWASRKMNRLT* |
Ga0070695_1005671252 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVHCRFGGMDAPEILIHTVVVAITVLGILISLAGIAFWWVSRKMNRLT* |
Ga0066905_1000209524 | 3300005713 | Tropical Forest Soil | MSMPEITIHTAILVIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0066905_1014367271 | 3300005713 | Tropical Forest Soil | MAGPEPLWAHCRFAAMTMPEITIHTAILVIGVLGILISLAGIAFWWVSRKMNRLT* |
Ga0066905_1014764121 | 3300005713 | Tropical Forest Soil | CCFGGMDAPDTFIHVAVLMIAVLGILISLAGIAFWWMSRKMNRLT* |
Ga0066905_1019290922 | 3300005713 | Tropical Forest Soil | MVSTEVVIHTAILVVAALGILISLAGIVFWWVSRKMNRLT* |
Ga0068858_1002876411 | 3300005842 | Switchgrass Rhizosphere | GMDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0081455_1000589218 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSVPEITIHTAILAIAVLGILISLAGIAFWWVSRKMKRLT* |
Ga0074055_117382522 | 3300006573 | Soil | MKSWITFLDKNAEPAPTHCRFGGMDAPEILVHTAVLLIGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0074050_120424072 | 3300006577 | Soil | VLAHCRFGGMDTPNVVFHTAILVIGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0074049_131914233 | 3300006580 | Soil | APAHCRFGGMDAPEILVHTAVLVIGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0074048_100466782 | 3300006581 | Soil | MRAEPAPVHCRFGGMDTPDALVHTAVSVIGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0074048_133531102 | 3300006581 | Soil | RFGGMDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0079222_110723352 | 3300006755 | Agricultural Soil | LELAPDHCRSGGMDAPDVIIHAVITALAVLAILVSLTGIVFWWVSRKMNRLT* |
Ga0075425_1002419583 | 3300006854 | Populus Rhizosphere | MAGREPLDAHCRFAAMSSAEITIHTAILVIAVLGILISLAGIAFWLVWRKMNRLT* |
Ga0075425_1006522342 | 3300006854 | Populus Rhizosphere | MSSAEIVIHTAILVVAVPGILIALAGIAFWWVLRKMNRLT |
Ga0075436_1007546891 | 3300006914 | Populus Rhizosphere | ITIHTAILVIAVLGILISLAGIAFWLVWRKMNRLT* |
Ga0111539_111075182 | 3300009094 | Populus Rhizosphere | MDASDTVIHIVVLVIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0105241_123770631 | 3300009174 | Corn Rhizosphere | GGMDTSDAVFHIAVLVIGVLGILLSLAGIAVWWASRKMNRLT* |
Ga0105242_105957141 | 3300009176 | Miscanthus Rhizosphere | APAHRRSGGMDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0105249_112663241 | 3300009553 | Switchgrass Rhizosphere | EILIHTVVVAIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0126382_102069413 | 3300010047 | Tropical Forest Soil | MPEITIHTAILVIAVLGILISLAGIAFWWVSRKMNRLT* |
Ga0126372_121002591 | 3300010360 | Tropical Forest Soil | MSLEEITIHIVILVVAVLGILIALAGIAFWWVSRKMNRLT* |
Ga0126377_107449602 | 3300010362 | Tropical Forest Soil | MSSDEIVIHTAILVVAVLGILVSLAGIAFWWVSRKLKRLT* |
Ga0134125_115055242 | 3300010371 | Terrestrial Soil | MDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRK |
Ga0134128_107602542 | 3300010373 | Terrestrial Soil | CRFGGMDALHATVHTAVLVLAVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0105239_123214412 | 3300010375 | Corn Rhizosphere | MDAQDAIVHIALLAVGVLGILISLAGIVFWWVSRKMNRLT* |
Ga0134122_118131501 | 3300010400 | Terrestrial Soil | MPDHCRFGGMDALHATVHTAVLVLAVLGILISLAGITFWWASRKMNRLT* |
Ga0134123_120522942 | 3300010403 | Terrestrial Soil | SEPVPVHCRFGGMDAPEILIHTVVVAITVLGILISLAGIAFWWVSRKMNRLT* |
Ga0157325_10009323 | 3300012485 | Arabidopsis Rhizosphere | MDTSDPVFHIAVLVIGVLGILLSLAGIAFWWASRKKNRLK* |
Ga0157286_100721802 | 3300012908 | Soil | MPAQCRFGGMDALHATVHTAVLVLAVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0164299_100286224 | 3300012958 | Soil | MDTSDAVLQDAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0164301_100032435 | 3300012960 | Soil | MSRITFLNRRSEPVPVHYRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT* |
Ga0157378_114271531 | 3300013297 | Miscanthus Rhizosphere | TSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0157372_106222663 | 3300013307 | Corn Rhizosphere | GGMDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0157377_108754981 | 3300014745 | Miscanthus Rhizosphere | PAPAHRRFGGMDASDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0157376_114934242 | 3300014969 | Miscanthus Rhizosphere | MDTSDAVFRIAVLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0173478_100094904 | 3300015201 | Soil | MDASDAVFHIAGLVIGVLGILLSLAGIAFWWASRKMNRLT* |
Ga0132258_130205892 | 3300015371 | Arabidopsis Rhizosphere | MGSPDAIVHTAVLVIGVLGILISLAGIAFWWVSRKMNRLT* |
Ga0132255_1055398732 | 3300015374 | Arabidopsis Rhizosphere | MGSPDAIVHTAVLVIGVLGILISLAGIVFWWVSRKMNRLT* |
Ga0173481_100010148 | 3300019356 | Soil | MDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0173482_100000918 | 3300019361 | Soil | MDASDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT |
Ga0173479_101460641 | 3300019362 | Soil | MDAPEILIHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0247792_10009592 | 3300022880 | Soil | MSRITFLNRRSEPVPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0247753_10365861 | 3300022892 | Soil | SDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT |
Ga0247744_10147172 | 3300023073 | Soil | VHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0247800_10025902 | 3300023263 | Soil | VPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0207654_110422211 | 3300025911 | Corn Rhizosphere | MDASDAVFHIAVLVIGVLGILLSLAGIAVWWASRKMNRLT |
Ga0207707_113970752 | 3300025912 | Corn Rhizosphere | PAHCRFGGMDTSDAVFHIAVLVIGVLGILLSLAGIAFWWASRKMNRLT |
Ga0207657_108394462 | 3300025919 | Corn Rhizosphere | MPAQCRFGGMDAPDAILHIALLVVGVLGILISLAGIVFWWVSRKMNRLT |
Ga0207652_108087852 | 3300025921 | Corn Rhizosphere | MDAPEILIHTVVVAITVLGILISLAGIAFWWVSRKMNRLT |
Ga0207694_115216232 | 3300025924 | Corn Rhizosphere | MDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNR |
Ga0207701_110816791 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDYLLQLRWELMPAQCRFGGMDAPDAILHIALLVVGVLGILISLAGIVFWWVSRKMNRL |
Ga0207711_115152531 | 3300025941 | Switchgrass Rhizosphere | MPDHCRFGGMDALHATVHTAVLVLAVLGILVSLAGIAFWWV |
Ga0207640_100875644 | 3300025981 | Corn Rhizosphere | MDTSDAVFHIAVLVIGVLGILLSLAGITFWWASRKMNRLT |
Ga0207640_116058611 | 3300025981 | Corn Rhizosphere | LLQLRWELMPAQCRFGGMDAPDAILHIALLVVGVLGILISLAGIVFWWVSRKMNRLT |
Ga0207658_107993882 | 3300025986 | Switchgrass Rhizosphere | MPAQCRFGGMDAPDAILHIALLVVGVLAILISLAGIVFWWVSRKMNRLT |
Ga0207471_1019102 | 3300026779 | Soil | VPVHYRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0207443_10022291 | 3300026853 | Soil | VPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRL |
Ga0209973_10587332 | 3300027252 | Arabidopsis Thaliana Rhizosphere | VPVHCRFGGMDAPEILIHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0207624_1060772 | 3300027453 | Soil | GGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0210002_10127483 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MDTPDAVFHTAVLVIAALGILISLAGIAFWWVSRKMNRLT |
Ga0209971_10589382 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MDYLLENNSEPVPVHCRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0209974_100122194 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VDLGTPALRGQELAPAHRRFGGMDTPDAVFHTAVLVIAALGILISLAGIAFWWVSRKMNRLT |
Ga0209974_100773962 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MDYLLENNSEPVPVHCRFGGMDAPEILIHTVVLAVAVLGILISLAGIAFWWLSRKMNRLT |
Ga0207428_105154032 | 3300027907 | Populus Rhizosphere | MDASDTVIHIVVLVIAVLGILISLAGIAFWWVSRKMNRLT |
Ga0268264_122930522 | 3300028381 | Switchgrass Rhizosphere | MPDHCRFGGMDALHATVHTAVLVIAVLGILVSLAGIAFWWVSRKMNRLT |
(restricted) Ga0255311_10028951 | 3300031150 | Sandy Soil | FGNNSEPVPVHCRFGGMDAPEILIHTVVLAIAVLGILISLAGIAFWWVSRKMNRLT |
(restricted) Ga0255310_100019515 | 3300031197 | Sandy Soil | MDAPEILIHTVVLAIAVLGILISLAGIAFWWVSRKMNRLT |
(restricted) Ga0255310_100174751 | 3300031197 | Sandy Soil | MDTPDDVFHTAVLVIGVLGILVSLAGIAFWWVSRKMNRLT |
(restricted) Ga0255312_10047614 | 3300031248 | Sandy Soil | VPVHCRFGGMDAPEILIHTVVLAIAVLGILISLAGIAFWWVSRKMNRLT |
Ga0310813_100213981 | 3300031716 | Soil | MDAQDAIVHTALLAVGVLGILISLAGIVFWWVSRKMNRLT |
Ga0310900_114220432 | 3300031908 | Soil | MRAEPAPVHCRFGGMDTPDALVHTAVSVIGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0310906_100946013 | 3300032013 | Soil | MRAEPAPVHCRFGGMDTPDALVHTAVLVIGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0315910_109929062 | 3300032144 | Soil | MDAPEILIHTVVFAVAVLGILISLAGIAFWWVSRKMKRLS |
Ga0307471_1012643872 | 3300032180 | Hardwood Forest Soil | MAEPEPSRVHCRFAAMDEHEIVFHTALLVIGVLGILISLAGIAFWWVSRKMNRLT |
Ga0307472_1001006703 | 3300032205 | Hardwood Forest Soil | MDEHEIVFHTALLVIGVLGILISLAGIAFWWVSRKMNRLT |
Ga0307472_1012554942 | 3300032205 | Hardwood Forest Soil | MSSAEIVIHTAILVVAVLGILIALAGIAFWWVLRKMNRLT |
Ga0307472_1026277351 | 3300032205 | Hardwood Forest Soil | MSRITFLNRRSEPVPVHYRFGGMDTPNVLFHTAVLVLGVLGILVSLAGIAFWWVSRKMNRLT |
Ga0335084_102948092 | 3300033004 | Soil | MGPPDVIVHTAILVIGVLGILISLAGIAFWWVSRKMNRLT |
⦗Top⦘ |