NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092013

Metagenome / Metatranscriptome Family F092013

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092013
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 50 residues
Representative Sequence EQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLTGATTTTTQ
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.80 %
% of genes near scaffold ends (potentially truncated) 96.26 %
% of genes from short scaffolds (< 2000 bps) 95.33 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.393 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.841 % of family members)
Environment Ontology (ENVO) Unclassified
(27.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.682 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF03819MazG 84.11
PF03952Enolase_N 12.15
PF13616Rotamase_3 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0148EnolaseCarbohydrate transport and metabolism [G] 12.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.39 %
UnclassifiedrootN/A5.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11648562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300001536|A1565W1_10403717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300004153|Ga0063455_101493161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300004157|Ga0062590_102158584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300004479|Ga0062595_100042188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2005Open in IMG/M
3300004480|Ga0062592_102528537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300004643|Ga0062591_102403934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005180|Ga0066685_10621274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300005184|Ga0066671_10586447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300005355|Ga0070671_100940337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300005367|Ga0070667_102288996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300005447|Ga0066689_10223527All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300005450|Ga0066682_10976011Not Available501Open in IMG/M
3300005468|Ga0070707_101348373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300005526|Ga0073909_10156373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium954Open in IMG/M
3300005544|Ga0070686_101848236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300005552|Ga0066701_10520901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300006046|Ga0066652_100127218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2102Open in IMG/M
3300006573|Ga0074055_10018458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300006606|Ga0074062_10047612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300006794|Ga0066658_10478925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300006794|Ga0066658_10577616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300006854|Ga0075425_102167246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300006953|Ga0074063_14217403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1137Open in IMG/M
3300009012|Ga0066710_102597257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300009012|Ga0066710_103950208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300009088|Ga0099830_11366078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300009098|Ga0105245_12052200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300009137|Ga0066709_101554422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300009148|Ga0105243_12124964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300010093|Ga0127490_1041043Not Available507Open in IMG/M
3300010322|Ga0134084_10361504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300010401|Ga0134121_12775381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300010905|Ga0138112_1046177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14610Open in IMG/M
3300012355|Ga0137369_10651068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300012356|Ga0137371_11316716Not Available534Open in IMG/M
3300012356|Ga0137371_11338646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300012362|Ga0137361_10738623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium898Open in IMG/M
3300012403|Ga0134049_1200975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300012910|Ga0157308_10403054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012930|Ga0137407_11280433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300012930|Ga0137407_12330015Not Available512Open in IMG/M
3300012957|Ga0164303_10212481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1080Open in IMG/M
3300012976|Ga0134076_10132482All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300012976|Ga0134076_10632611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300012977|Ga0134087_10121680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1112Open in IMG/M
3300012986|Ga0164304_11321423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300012988|Ga0164306_10385486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1049Open in IMG/M
3300012988|Ga0164306_11418536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300013100|Ga0157373_11130242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300013296|Ga0157374_10191245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2002Open in IMG/M
3300013296|Ga0157374_11153903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300013765|Ga0120172_1065159All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300015356|Ga0134073_10336632Not Available550Open in IMG/M
3300015372|Ga0132256_100616825All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300017654|Ga0134069_1356260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300018027|Ga0184605_10087802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1362Open in IMG/M
3300018027|Ga0184605_10332215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300018027|Ga0184605_10497823Not Available531Open in IMG/M
3300018051|Ga0184620_10217268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300018054|Ga0184621_10007432All Organisms → cellular organisms → Bacteria3065Open in IMG/M
3300018081|Ga0184625_10248196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300018433|Ga0066667_11290941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300019867|Ga0193704_1033410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1034Open in IMG/M
3300019869|Ga0193705_1036226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1050Open in IMG/M
3300019875|Ga0193701_1022962All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300019882|Ga0193713_1189598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300021510|Ga0222621_1009676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1804Open in IMG/M
3300025315|Ga0207697_10452190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300025922|Ga0207646_11473312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300025924|Ga0207694_10601044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium925Open in IMG/M
3300025931|Ga0207644_10776248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300025931|Ga0207644_11777533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300025949|Ga0207667_12016415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300025960|Ga0207651_11008146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300026325|Ga0209152_10100873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1087Open in IMG/M
3300026343|Ga0209159_1180866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300026538|Ga0209056_10328257All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300026552|Ga0209577_10850008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300027866|Ga0209813_10447177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300027882|Ga0209590_10262698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1103Open in IMG/M
3300028704|Ga0307321_1037223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium898Open in IMG/M
3300028707|Ga0307291_1190196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300028711|Ga0307293_10203797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300028719|Ga0307301_10226950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300028784|Ga0307282_10544232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300028791|Ga0307290_10272089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300028799|Ga0307284_10241271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300028799|Ga0307284_10321609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300028807|Ga0307305_10076339All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300028810|Ga0307294_10251947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300028811|Ga0307292_10237754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300028814|Ga0307302_10182934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1020Open in IMG/M
3300028819|Ga0307296_10137153All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300028824|Ga0307310_10050325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1738Open in IMG/M
3300028828|Ga0307312_10080630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1989Open in IMG/M
3300028828|Ga0307312_10813358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300028872|Ga0307314_10137360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300028878|Ga0307278_10036807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2229Open in IMG/M
3300028878|Ga0307278_10054062All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300028881|Ga0307277_10271791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300028881|Ga0307277_10571630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300028884|Ga0307308_10658753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300028885|Ga0307304_10176303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300031152|Ga0307501_10262747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031543|Ga0318516_10797945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300032180|Ga0307471_101147422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1164856223300000891SoilRDAMTKWVDDTKNKYCNSRIKYQVGYAPNPDPCATTGTTTSQ*
A1565W1_1040371723300001536PermafrostAMTKWVETKKKSYCKSGIKYQIGYQPNPDPCATLTGATTTTTQ*
Ga0063455_10149316113300004153SoilIKQQLGQQKKNDKITKWLEDTKKSYCNGKIKYQVGYTPSPDPCVTLTGATSTSQ*
Ga0062590_10215858423300004157SoilQLEDQQKRDAMTKWVDDTKNKYCKSRIKYQVGFAPNPDPCVTTGTTTSQ*
Ga0062595_10004218813300004479SoilSIKQQLEQQRKNDEMTKWVEDKKKSYCKSGIKYQVGYQPNPDPCATVSGTTTTTSQ*
Ga0062592_10252853713300004480SoilDKITKWLEDTKKGYCGGKIKYQIGYEPNPDPCATLTGATSTSQ*
Ga0062591_10240393423300004643SoilQQLEQQRKNDAMTKWVDQKKKSYCKSGIKYQVGYQPNPDPCATVTGTTDRTTTSQ*
Ga0066685_1062127413300005180SoilVEDKKKQYCGSKIKYQVGYEPNPQADPCASVTGTTTTSP*
Ga0066671_1058644713300005184SoilLEQQRKNDKMTQWLANTKKDYCNGRIKYQVGYQPNPDPCASLTSTASTTG*
Ga0070671_10094033713300005355Switchgrass RhizosphereKNDVMTRWVADKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ*
Ga0070667_10228899613300005367Switchgrass RhizosphereSTTSLAKVKASIKQQLTQQKKNDKLTKWLEDTKKSYCGGKIKYQIGYTPNPDPCAALTGSTATSQ*
Ga0066689_1022352733300005447SoilEAMTKWVDKKKQSFCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ*
Ga0066682_1097601113300005450SoilQRKNDKITKWLEETKKDYCSGKIKYQVGYQPNPDPCATLTSSTTSTQ*
Ga0070707_10134837323300005468Corn, Switchgrass And Miscanthus RhizosphereSQPLSKVSATIKTQLEQQRKNDKMTKWLTDTKKNYCNSRIKYQVGYQPSPDPCASVTSSTSTSK*
Ga0073909_1015637323300005526Surface SoilKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGATTTTSQ*
Ga0070686_10184823613300005544Switchgrass RhizosphereAIKPAQTTSLSKVESSIKQQLEQQRKNDVMTRWVADKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ*
Ga0066701_1052090123300005552SoilKKSFCKSGIKYQIGYQPNPDPCATLTGSTTTTTQ*
Ga0066652_10012721813300006046SoilSIRQQLEQQRKNDQITKWLDDTKKSYCNGKIKYQIGYQPSPDPCATLTGATSTSQ*
Ga0074055_1001845813300006573SoilSIKQQLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ*
Ga0074062_1004761213300006606SoilSMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ*
Ga0066658_1047892513300006794SoilVDKKKQSFCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ*
Ga0066658_1057761613300006794SoilSGKVKASIKQQLEQQRKNDKMTQWLANTKKDYCNGRIKYQVGYQPNPDPCASLTSTASTTG*
Ga0075425_10216724613300006854Populus RhizosphereDDTKKSYCNGKIKYQIGYQPNPDPCATVTGATSTSK*
Ga0074063_1421740313300006953SoilQQLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ*
Ga0066710_10259725713300009012Grasslands SoilNDLMTKWVENKKKSYCKSRIKYQVGYEPNPDPCASVTGATTTSP
Ga0066710_10395020813300009012Grasslands SoilSIKQQLEQQRKNDAMTKRVDDKKKSFCKSGIKYQIGYQPNPDPCATLTGSTTTTTQ
Ga0099830_1136607813300009088Vadose Zone SoilDNKKTSFCKSGIKYQVGYQPSPDPCATLTGTTTTG*
Ga0105245_1205220013300009098Miscanthus RhizosphereKPASTTSLAKVKASIKQQLTQQKKNDKLTKWLEDTKKSYCGGKIKYQIGYTPNPDPCAALTGSTATSQ*
Ga0066709_10155442213300009137Grasslands SoilQKTPFDSVKASIKQQLEQQKKTEQVTKWDESTRKYFCGDTRIKYQVGYQPNPDPCAALTASTQTT*
Ga0105243_1212496423300009148Miscanthus RhizosphereVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ*
Ga0127490_104104313300010093Grasslands SoilMKGPATSLSKVESSIRQQLEQQRKNEAMTKWVETKRKSYCKSGIKYQVGYQPNPDPCATV
Ga0134084_1036150413300010322Grasslands SoilNDKVTKWLDDTKKSYCNGKIKYQIGYQPNPDPCATLTSSTATTG*
Ga0134121_1277538113300010401Terrestrial SoilMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ*
Ga0138112_104617713300010905Grasslands SoilVRASIQQQLEQQKKNDKITKWLEDTKKGYCNNKIKYQIGYQPSPDPCATLTGATSTSQ*
Ga0137369_1065106813300012355Vadose Zone SoilKNDKITKWLEDTKKDYCSGKIKYQVGYQPNPDPCATLTSSTTSTQ*
Ga0137371_1131671623300012356Vadose Zone SoilSLSKVESSIKQQLEQQRKNDAMTKWVETKKKSFCKSGIKYQVGYQPNPDPCATLTGTTTTG*
Ga0137371_1133864613300012356Vadose Zone SoilDKKKKSYCKSGIKYQVGYQPNPDPCATVTGTTTTTSQ*
Ga0137361_1073862313300012362Vadose Zone SoilKKKSFCKSGIKYQVGYQPNPDPCATLTGSTTTTTQ*
Ga0134049_120097513300012403Grasslands SoilMTKWVETKKKSFCKSGIKYQVGYQPNPDPCATLTGTTTTG
Ga0157308_1040305413300012910SoilTKWVETKKKSYCRSGIKYQVGYQPNPDPCATLPGATTTTTQ*
Ga0137407_1128043323300012930Vadose Zone SoilVMTKWVDKKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ*
Ga0137407_1233001523300012930Vadose Zone SoilMTKWVDKKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ*
Ga0164303_1021248113300012957SoilLADTKKSYCGGKIKYQIGYQPNPDPCATLTGSTSTTQ*
Ga0134076_1013248223300012976Grasslands SoilLSKVESSIKQQLEQQRKNDAMTKWVETKKTSFCKSGIKYQVGYQPNPDPCATLTGTTTTG
Ga0134076_1063261123300012976Grasslands SoilQQRKNDAMTKWVETKKTSFCKSGIKYQVGYQPNPDPCATVTGATTTTSQ*
Ga0134087_1012168023300012977Grasslands SoilMTKWVDDKKKSFCRSGIKYQIGYQPNPDPCATLTGSTTTTTQ*
Ga0164304_1132142313300012986SoilSKVESSIKQQLEQQRKNDVMTKWVTDKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ*
Ga0164306_1038548613300012988SoilNDEITKWLADTKKSYCGGKIKYQIGYQPNPDPCATLTGSTSTTQ*
Ga0164306_1141853623300012988SoilADKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ*
Ga0157373_1113024213300013100Corn RhizosphereQQRKNDAMTKWVETKKKSYCKAGIKYQVGYQPNPDPCATLPGATTTTSQ*
Ga0157374_1019124533300013296Miscanthus RhizosphereQLEQQRKNDVMTRWVADKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ*
Ga0157374_1115390313300013296Miscanthus RhizosphereAKVKASIKQQLTQQKKNDKLTKWLEDTKKSYCGGKIKYQIGYTPNPDPCAALTGSTATSQ
Ga0120172_106515923300013765PermafrostMSKVEASIKGQLEQQRKNDAMTKWVEDTKKDYCKSRIKYQVGYRPNPDPCLTTGTTTSQ*
Ga0134073_1033663223300015356Grasslands SoilDNKKSYCNGKIKYQVGYQPSPDPCATLTGATSTSQ*
Ga0132256_10061682513300015372Arabidopsis RhizosphereQQLEQQKKNDEITKWLENTKKSYCGGKIKYQVGYQPNPDPCAAVTNAATTG*
Ga0134069_135626013300017654Grasslands SoilKKQYCGSKIKYQVGYEPNPQADPCASVTGATTTSP
Ga0184605_1008780213300018027Groundwater SedimentQQLEQQKKNQVMTKWVDKKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ
Ga0184605_1033221523300018027Groundwater SedimentAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATVTGATTTTTQ
Ga0184605_1049782313300018027Groundwater SedimentTKWVETKRKSYCKSGIKYQVGYQPNPDPCATVTGATTTTSQ
Ga0184620_1021726823300018051Groundwater SedimentAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0184621_1000743213300018054Groundwater SedimentKQQLEQQKKNEVMTKWVDKKKQTYCKSGIKYQVGYQPNPDPCATVTGTTTTTSQ
Ga0184625_1024819623300018081Groundwater SedimentQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0066667_1129094113300018433Grasslands SoilKNELMTNWVNDMKKKYCKPGGIKYAQGYQPTPDPCASVSGTTTTTK
Ga0193704_103341013300019867SoilQLEQQRKNDKVTKWLADTKKGYCGGKIKYQVGYQPNPDPCVTLTNSTTTSQ
Ga0193705_103622633300019869SoilEQQRKNDKVTKWLADTKKGYCGGKIKYQVGYQPNPDPCVTLTNSTTTSQ
Ga0193701_102296213300019875SoilSLDKVRASIKQQLEQQRKNDKVTKWLADTKKGYCGGKIKYQVGYQPNPDPCVTLTNSTTTSQ
Ga0193713_118959813300019882SoilKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0222621_100967633300021510Groundwater SedimentSKVQASIKQQLEQQHKNDAMTKWVDKKKQTYCKSGIKYQVGYQPNPDPCATVTGTTTTTS
Ga0207697_1045219013300025315Corn, Switchgrass And Miscanthus RhizosphereIRQQLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0207646_1147331223300025922Corn, Switchgrass And Miscanthus RhizosphereQQLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCAQYTATTTTPTTTG
Ga0207694_1060104423300025924Corn RhizosphereSMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0207644_1077624823300025931Switchgrass RhizosphereKVEASIKQQLEQQRKNDVMTRWVADKKKSYCKAGIKYQVGYQPNPDPCASVTGATTTTTQ
Ga0207644_1177753323300025931Switchgrass RhizosphereAIKPASTTSLAKVKASIKQQLTQQKKNDKLTKWLEDTKKSYCGGKIKYQIGYTPNPDPCAALTGSTATSQ
Ga0207667_1201641523300025949Corn RhizosphereTTSLAKVKASIKQQLTQQKKNDKLTKWLEDTKKSYCGGKIKYQIGYTPNPDPCAALTGSTATSQ
Ga0207651_1100814613300025960Switchgrass RhizosphereEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0209152_1010087313300026325SoilSGKVKASIKQQLEQQRKNDKMTQWLANTKKDYCNGRIKYQVGYQPNPDPCASLTSTASTT
Ga0209159_118086613300026343SoilQQLEQQRKNDVMTKWVEKKKKSFCKSGIKYQVGYQPNPDPCATLTGTTTTTTQ
Ga0209056_1032825713300026538SoilESTKWLENTKKDYCGGRIKYQVGYQPNPDPCATVTSSTSTG
Ga0209577_1085000813300026552SoilVMTKWVDQKKKDYCKSSIKYQVGYAPNPDPCASTTAATTTSQ
Ga0209813_1044717713300027866Populus EndosphereVTKWLDDTKKSYCNGKIKYQIGYQPNPDPCATVTGATSTSK
Ga0209590_1026269833300027882Vadose Zone SoilKQQLEQQKKNDVMTKWVDDKKKSFCKSGIKYQVGYQPSPDPCATLTGTTTTG
Ga0307321_103722313300028704SoilSIKQQLEQQRKNDAMTKWVDTKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0307291_119019623300028707SoilEQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLTGATTTTTQ
Ga0307293_1020379723300028711SoilQQLEQQRKNEAMTKWVETKRKSYCKSGIKYQVGYQPNPDPCATVTGATTTTSQ
Ga0307301_1022695023300028719SoilASIKQQLEQQRKNDKVTKWLADTKKNYCGGKIQYQVGYQPNPDPCVTLTNSTTTSQ
Ga0307282_1054423223300028784SoilLAKVEKTIKQNLEDQQKRDAMTRWVQDKTKNYCKSGIKYQVGYAPVNDPCLTTGTTTSK
Ga0307290_1027208913300028791SoilQASIKQQLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ
Ga0307284_1024127123300028799SoilKWVETKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0307284_1032160913300028799SoilVETSIKQNLEDQQKRDAMTKWVQDKTKSYCKSGIKYQVGYAPVNDPCLTTGTTTSQ
Ga0307305_1007633913300028807SoilPLAKVEKSIKQNLEDQQKRDAMTKWVQDKTKSYCKSGIKYQVGYAPVNDPCLTTGTTTSQ
Ga0307294_1025194713300028810SoilSIKTQLEQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLTGATTTTTQ
Ga0307292_1023775423300028811SoilKTQLEQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0307302_1018293413300028814SoilQQLEQQQKNDKVTKWLADTKKNYCGGKIQYQVGYQPNPDPCVTLTNSTTTSQ
Ga0307296_1013715313300028819SoilQLEQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0307310_1005032533300028824SoilVMTKWVDKKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ
Ga0307312_1008063013300028828SoilQQLEQQKKNEVMTKWVDKKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ
Ga0307312_1081335813300028828SoilQQRKNDKVTKFLEDTKKTYCGGKIKYQIGYQPNPDPCATLTGASSTSQ
Ga0307314_1013736023300028872SoilKQQLEQQRKNDAMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLTGATTTTTQ
Ga0307278_1003680713300028878SoilLEQQRKNEAMTTWVETKRKSYCKSGIKYQVGYQPNPDPCATVTGATTTTSQ
Ga0307278_1005406233300028878SoilQRKNDKVTKWLADTKKDYCGGKIKYQVGYQPNPDPCVTLTNSTTTSQ
Ga0307277_1027179113300028881SoilEQQRKNEAMTKWVETKRKSYCKSGIKYQVGYQPNPDPCATVTGATTTTSQ
Ga0307277_1057163013300028881SoilKQQLEQQQKNDKVTKWLADTKKNYCGGKIQYQVGYQPNPDPCVTLTNSTTTSQ
Ga0307308_1065875313300028884SoilKKKSYCKSGIKYQVGYQPNPDPCATLTGTTTTTSQ
Ga0307304_1017630323300028885SoilLAKVEKSIKQNLEDQQKRDAMTKWVQDKTKSYCKSGIKYQVGYAPVNDPCLTTGTTTSQ
Ga0307501_1026274723300031152SoilMTKWVETKKKSYCKSGIKYQVGYQPNPDPCATLPGATTTTTQ
Ga0318516_1079794523300031543SoilQKKNDEITKWLTDTKKSYCSGKIKYQVGYQPSPDPCSTLTNATTTG
Ga0307471_10114742223300032180Hardwood Forest SoilLEQQRKNESMTKWVDDKKKQYCKSGIKYQIGYQPNPDPCATLSGSTTTTSQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.