NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092455

Metagenome / Metatranscriptome Family F092455

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092455
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 56 residues
Representative Sequence VNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETDEDEEPA
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.77 %
% of genes near scaffold ends (potentially truncated) 27.10 %
% of genes from short scaffolds (< 2000 bps) 89.72 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.981 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.364 % of family members)
Environment Ontology (ENVO) Unclassified
(46.729 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.664 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.57%    β-sheet: 0.00%    Coil/Unstructured: 46.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF13510Fer2_4 50.47
PF10589NADH_4Fe-4S 44.86
PF00329Complex1_30kDa 0.93
PF00420Oxidored_q2 0.93
PF00346Complex1_49kDa 0.93
PF00146NADHdh 0.93
PF012572Fe-2S_thioredx 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 0.93
COG0650Formate hydrogenlyase subunit HyfCEnergy production and conversion [C] 0.93
COG0852NADH:ubiquinone oxidoreductase 27 kD subunit (chain C)Energy production and conversion [C] 0.93
COG1005NADH:ubiquinone oxidoreductase subunit 1 (chain H)Energy production and conversion [C] 0.93
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.93
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 0.93
COG3262Ni,Fe-hydrogenase III component GEnergy production and conversion [C] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.98 %
UnclassifiedrootN/A14.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_119875798All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300002568|C688J35102_120841049All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300003990|Ga0055455_10030232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus1396Open in IMG/M
3300004479|Ga0062595_101293395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300005162|Ga0066814_10066090All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005168|Ga0066809_10124805All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300005169|Ga0066810_10096000All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300005331|Ga0070670_102000803All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300005334|Ga0068869_100216296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1517Open in IMG/M
3300005335|Ga0070666_11276505All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300005339|Ga0070660_100240788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1474Open in IMG/M
3300005340|Ga0070689_100267353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1415Open in IMG/M
3300005341|Ga0070691_10206902All Organisms → cellular organisms → Bacteria → Terrabacteria group1033Open in IMG/M
3300005343|Ga0070687_100131712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300005347|Ga0070668_101086372All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005365|Ga0070688_100484211All Organisms → cellular organisms → Bacteria → Terrabacteria group930Open in IMG/M
3300005406|Ga0070703_10069686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1172Open in IMG/M
3300005437|Ga0070710_10826328All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005439|Ga0070711_100226906Not Available1455Open in IMG/M
3300005440|Ga0070705_100536026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300005444|Ga0070694_100855114All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300005456|Ga0070678_100839012All Organisms → cellular organisms → Bacteria → Terrabacteria group837Open in IMG/M
3300005457|Ga0070662_100907460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300005546|Ga0070696_100213934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1444Open in IMG/M
3300005563|Ga0068855_100292735Not Available1805Open in IMG/M
3300005564|Ga0070664_100547837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1069Open in IMG/M
3300005577|Ga0068857_100120316All Organisms → cellular organisms → Bacteria2363Open in IMG/M
3300005578|Ga0068854_100957075All Organisms → cellular organisms → Bacteria → Terrabacteria group756Open in IMG/M
3300005614|Ga0068856_101577958Not Available670Open in IMG/M
3300005615|Ga0070702_100014955All Organisms → cellular organisms → Bacteria3949Open in IMG/M
3300006046|Ga0066652_100296834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1434Open in IMG/M
3300006046|Ga0066652_101415271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300006058|Ga0075432_10530143All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300006175|Ga0070712_101790000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300006573|Ga0074055_11762218All Organisms → cellular organisms → Bacteria → Terrabacteria group850Open in IMG/M
3300006575|Ga0074053_10014477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1392Open in IMG/M
3300006577|Ga0074050_10012304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300006577|Ga0074050_11866209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300006578|Ga0074059_12059667Not Available977Open in IMG/M
3300006579|Ga0074054_12174565Not Available643Open in IMG/M
3300006581|Ga0074048_13272744Not Available537Open in IMG/M
3300006605|Ga0074057_12321155All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300009162|Ga0075423_10019052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6787Open in IMG/M
3300009551|Ga0105238_10416063All Organisms → cellular organisms → Bacteria → Terrabacteria group1338Open in IMG/M
3300010371|Ga0134125_10395340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1533Open in IMG/M
3300010401|Ga0134121_10343208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1334Open in IMG/M
3300011106|Ga0151489_1038288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1430Open in IMG/M
3300011107|Ga0151490_1236097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300012914|Ga0157297_10512498All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300012955|Ga0164298_10101579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1524Open in IMG/M
3300012955|Ga0164298_11037568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300012955|Ga0164298_11400874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300012960|Ga0164301_10519925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis862Open in IMG/M
3300012988|Ga0164306_11141261All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300012989|Ga0164305_10084593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1985Open in IMG/M
3300012989|Ga0164305_12217710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300013105|Ga0157369_11131081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis800Open in IMG/M
3300013306|Ga0163162_10027722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5602Open in IMG/M
3300013306|Ga0163162_10421909Not Available1466Open in IMG/M
3300014325|Ga0163163_11206944All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300014969|Ga0157376_10066459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3048Open in IMG/M
3300015371|Ga0132258_12266132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter1363Open in IMG/M
3300017792|Ga0163161_11458455All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300019875|Ga0193701_1094880All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300025552|Ga0210142_1026195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1100Open in IMG/M
3300025900|Ga0207710_10614696All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300025901|Ga0207688_10251196All Organisms → cellular organisms → Bacteria → Terrabacteria group1071Open in IMG/M
3300025903|Ga0207680_11134289All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300025917|Ga0207660_11605366Not Available524Open in IMG/M
3300025921|Ga0207652_10224261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1693Open in IMG/M
3300025932|Ga0207690_10853119All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025935|Ga0207709_10784946Not Available768Open in IMG/M
3300025936|Ga0207670_10943141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium724Open in IMG/M
3300025972|Ga0207668_11536112All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300026008|Ga0208529_1006285All Organisms → cellular organisms → Bacteria → Terrabacteria group1008Open in IMG/M
3300026009|Ga0208530_1004000Not Available1010Open in IMG/M
3300026023|Ga0207677_11550125Not Available613Open in IMG/M
3300026089|Ga0207648_10486461Not Available1128Open in IMG/M
3300026116|Ga0207674_10051850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4186Open in IMG/M
3300026121|Ga0207683_10023796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5269Open in IMG/M
3300026142|Ga0207698_10107605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium2328Open in IMG/M
3300026142|Ga0207698_10236335All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300027523|Ga0208890_1079345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300028379|Ga0268266_10215237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1764Open in IMG/M
3300028381|Ga0268264_12521208Not Available519Open in IMG/M
3300028587|Ga0247828_10104898All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300028711|Ga0307293_10031920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1595Open in IMG/M
3300028715|Ga0307313_10037614All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300028720|Ga0307317_10049742All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300028721|Ga0307315_10006140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2928Open in IMG/M
3300028755|Ga0307316_10022855All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300028768|Ga0307280_10049131Not Available1315Open in IMG/M
3300028771|Ga0307320_10145224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300028771|Ga0307320_10389441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium559Open in IMG/M
3300028787|Ga0307323_10225634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300028791|Ga0307290_10035882All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300028793|Ga0307299_10041041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter1695Open in IMG/M
3300028807|Ga0307305_10500833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium544Open in IMG/M
3300028824|Ga0307310_10487132All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300028828|Ga0307312_10077748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2024Open in IMG/M
3300028878|Ga0307278_10149889All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300031184|Ga0307499_10101218All Organisms → cellular organisms → Bacteria → Terrabacteria group789Open in IMG/M
3300031938|Ga0308175_100364668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1497Open in IMG/M
3300031938|Ga0308175_102312635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300033433|Ga0326726_10237612All Organisms → cellular organisms → Bacteria1693Open in IMG/M
3300033433|Ga0326726_11940338All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300034819|Ga0373958_0215140Not Available509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.41%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026008Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes)EnvironmentalOpen in IMG/M
3300026009Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11987579823300000956SoilVNTFHDAFFEARRKIEAGADPEQVVPVLLKLAEDQDEIELAEELYDDEPGADEDAER*
C688J35102_12084104923300002568SoilVNTFHDAFLDARRRIESGDDPEEVVPVLLRLAEAQDEIDLVQGLYADGDGPDGEDEDG*
Ga0055455_1003023223300003990Natural And Restored WetlandsVNTFHDAFLDARRRIESGADPEAIVPVLLKLAEADDEIELAEDLYGDRLDDDGEPG*
Ga0062595_10129339523300004479SoilMNTFHDAFLDARRRIEAGADPELVVPVLLKLAEADDEIELAGELYADEAEDDSEAEA*
Ga0066814_1006609023300005162SoilLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGDDAEDEDA*
Ga0066809_1012480513300005168SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGDDAEDEDA*
Ga0066810_1009600013300005169SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIELVQGLYGEDEDADAEDEDA*
Ga0070670_10200080313300005331Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGDDDEEPA*
Ga0068869_10021629623300005334Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIGLAQELYDDETEDEEPA*
Ga0070666_1127650523300005335Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETGDDDEEPDG*
Ga0070660_10024078823300005339Corn RhizosphereFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG*
Ga0070689_10026735323300005340Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADE
Ga0070691_1020690223300005341Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETDEDEEPDG*
Ga0070687_10013171223300005343Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETDEDEEQDG*
Ga0070668_10108637223300005347Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETDEDEEPA*
Ga0070688_10048421113300005365Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGEDDEEPA*
Ga0070703_1006968623300005406Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEVVLAQELYADEAGDDDEEPA*
Ga0070710_1082632823300005437Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFMDVRSRIESGTADPEEVVPGLLRLAEAQEEIDMAEALYADEADEADDE*
Ga0070711_10022690623300005439Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGDDDEEPDG*
Ga0070705_10053602623300005440Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGDDDEEPDG*
Ga0070694_10085511413300005444Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADE
Ga0070678_10083901223300005456Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETG
Ga0070662_10090746023300005457Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG*
Ga0070696_10021393423300005546Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADEAGDDDEEPA*
Ga0068855_10029273513300005563Corn RhizosphereARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETDEDEEPDG*
Ga0070664_10054783723300005564Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG*
Ga0068857_10012031623300005577Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPA*
Ga0068854_10095707523300005578Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGDDDEEPA*
Ga0068856_10157795823300005614Corn RhizosphereAGVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0070702_10001495523300005615Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGGDDEEPA*
Ga0066652_10029683423300006046SoilVSTFHDAFFEARRKIEAGADPEQVVPMLLKLAEDQDEIELAQELYDDEPDEDAEL*
Ga0066652_10141527123300006046SoilMSTFHDAFLDARRRIESGADREEVVPVLLRLAEAQDEIDLAQGLYGDDAEDEDA*
Ga0075432_1053014313300006058Populus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGGDDEEPDG*
Ga0070712_10179000023300006175Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0074055_1176221823300006573SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGDD
Ga0074053_1001447723300006575SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYNDAEDEDEDG*
Ga0074050_1001230423300006577SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAADEIDLAQGLYADDDAEDEDADA*
Ga0074050_1186620923300006577SoilVNTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIELVQGLYGEDEDADAEDEDA*
Ga0074059_1205966723300006578SoilTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0074054_1217456513300006579SoilFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYDDAEDEDEDG*
Ga0074048_1327274413300006581SoilGAGVSTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0074057_1232115523300006605SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAADEIDLAQGLYADDDTEDADA*
Ga0075423_1001905253300009162Populus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETDEDEEQDG*
Ga0105238_1041606323300009551Corn RhizosphereVNTFHDAFLDARRRIEAGADPEEVVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG*
Ga0134125_1039534023300010371Terrestrial SoilVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEADETEDEEPA*
Ga0134121_1034320823300010401Terrestrial SoilVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAPELYADETGGDDEEPA*
Ga0151489_103828823300011106SoilVSTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0151490_123609723300011107SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGNGDAEDGDDDG*
Ga0157297_1051249823300012914SoilVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDD
Ga0164298_1010157923300012955SoilVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPAGEDG*
Ga0164298_1103756823300012955SoilVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEADEDEEPA*
Ga0164298_1140087423300012955SoilVNTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGGDEDEDA*
Ga0164301_1051992523300012960SoilVNTFHDAFLDARRRIESGADPEEVVPVLLRLAEAHDEIDLVQGLYADGEDPDAEDEGA*
Ga0164306_1114126113300012988SoilVNTFHDAFLDARRRIGSGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0164305_1008459323300012989SoilVNTFHDAFLDARRRIESGADPEEIVPILLRLAEADDEIGLAQGLYADDDDPDGEDG*
Ga0164305_1221771023300012989SoilMSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYAEGDDPDAEGEDA*
Ga0157369_1113108113300013105Corn RhizosphereLEPDRLALPRARRGAGVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG*
Ga0163162_1002772263300013306Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYDDETEDEEPA*
Ga0163162_1042190913300013306Switchgrass RhizosphereVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDD
Ga0163163_1120694423300014325Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAAAEDEIVLAQELYADETDEDEEQDG*
Ga0157376_1006645943300014969Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQEPSADETGGDDEEPA*
Ga0132258_1226613223300015371Arabidopsis RhizosphereVNTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEVDLVQGLYADGDDEDEDA*
Ga0163161_1145845523300017792Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIGLAQELYDDETEDEEPA
Ga0193701_109488023300019875SoilMSTFHDAFLDARRRIESGADPEEVVPMLLRLAEAQDEIDLVQGLYGD
Ga0210142_102619523300025552Natural And Restored WetlandsVNTFHDAFLDARRRIESGADPEAIVPVLLKLAEADDEIELAEDLYGDRLDDDGEPG
Ga0207710_1061469613300025900Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPDG
Ga0207688_1025119613300025901Corn, Switchgrass And Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDNDEEPDG
Ga0207680_1113428923300025903Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETDEDEE
Ga0207660_1160536623300025917Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETDEDEEQDG
Ga0207652_1022426123300025921Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGDDDEEPA
Ga0207690_1085311923300025932Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETDEDEEPDG
Ga0207709_1078494613300025935Miscanthus RhizosphereALPRPRGGAGVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG
Ga0207670_1094314113300025936Switchgrass RhizosphereAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETDEDEEQDG
Ga0207668_1153611223300025972Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEEVVPVLLKLAEAEDEIVLAQELYADETDEDEEPDG
Ga0208529_100628523300026008Rice Paddy SoilVNTFHDAFLDARRRIESGADAEQIVPALLKLAEAADEIELAQGLYEDEDKDEEPG
Ga0208530_100400023300026009Rice Paddy SoilRPRRGACVNTFHDAFLDARRRIESGADAEQIVPALLKLAEAADEIELAQGLYEDEDKDEEPG
Ga0207677_1155012523300026023Miscanthus RhizosphereMNTFHDAFLDARRRIEAGADPELVVPVLLKLAEADDEIELAGELYADEAEDDSEAEA
Ga0207648_1048646113300026089Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEEVVPVLLKLAEAEDEIVLAQELYADETGD
Ga0207674_1005185023300026116Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQIVPVLLKLAEAQDEIVLAQELYADETGDDDEEPA
Ga0207683_1002379623300026121Miscanthus RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAAAEDEIVLAQELYADETGGDDEEPA
Ga0207698_1010760513300026142Corn RhizosphereAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGDDDEEPDG
Ga0207698_1023633513300026142Corn RhizosphereVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGDDDE
Ga0208890_107934523300027523SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADGDDAEDEDA
Ga0268266_1021523723300028379Switchgrass RhizosphereVNTFHDAFLDARRRIEAGADPEEVVPVLLKLAEAEDEIVLAQELYADETGGDDEEPA
Ga0268264_1252120813300028381Switchgrass RhizosphereNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADEAGDDDEEPA
Ga0247828_1010489823300028587SoilVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIVLAQELYADETGDDDEEPA
Ga0307293_1003192033300028711SoilMSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYAHD
Ga0307313_1003761423300028715SoilMSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYGDGGDAEDEDA
Ga0307317_1004974223300028720SoilMSTFHDAFLDARRRIESGADPEEVVPMLLRLAEAQDEIDLVQGLYGDGGDAEDEDA
Ga0307315_1000614023300028721SoilMSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYAHDDAEDEDDDA
Ga0307316_1002285523300028755SoilFLDARRRIESGADPEEVVPMLLRLAEAQDEIDLVQGLYGDGVDAEDEDA
Ga0307280_1004913123300028768SoilMSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLVQGLYADDDAED
Ga0307320_1014522423300028771SoilMSTFHDAFLDARRRIESGADPEEVVPILLRLAEAQDEIDLVQGLYGDGVDAEDEDA
Ga0307320_1038944113300028771SoilALPRPRGGAGVSTFHDAFLDARRRIQSGADPEEVVPILLRLAEADDEIDLAQGLYADDDPDDEAG
Ga0307323_1022563423300028787SoilMSTFHDAFLDARRRIQSGADPEEVVPILLRLAEADDEIDLAQGLYADDDPDDEAG
Ga0307290_1003588223300028791SoilMSTFHDAFLDARRRIESGADPEEVVPVLLGLAEAQDEIDLVQGLYAHDDAEDEDDDA
Ga0307299_1004104123300028793SoilMSTFHDAFLDARRRIESGADPEEVVPMLLRLAEAQDEIDLVQGLYGDGVDAEDEDA
Ga0307305_1050083323300028807SoilLAVPRPRGGAGVNTFHDAFRDARRRIESGADPEEVVPILLRLAEAEDEIDLAQGLYADDDPDGED
Ga0307310_1048713213300028824SoilVSTFHDAFLDARRRIESGADPEEIVPVLLKLAEAEDEIQLAEGLYDDELDEESA
Ga0307312_1007774823300028828SoilVNTFHDAFRDARRRIESGADPEEVVPILLRLAEAEDEIDLAQGLYADDDPDGED
Ga0307278_1014988923300028878SoilVSTFHDAFRDARRRIESGADPEEVVPVLLRLAEAQDEIDLAQALYTDDDAEDDDA
Ga0307499_1010121813300031184SoilVNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDDPDGEDG
Ga0308175_10036466823300031938SoilVNTFHDAFLDARRRIEAGADPELVVPVLLKLAEADDEIELAGELYADEPEDDSEAEA
Ga0308175_10231263523300031938SoilVNTFHDAFLDARRRIEAGADPEQVVPVLLKLAEAEDEIGLAEELYEDETDEDKDG
Ga0326726_1023761223300033433Peat SoilVSTFHDAFLDARRRIESGADPEEVVPVLLRLAEAADEIDLAQGLYADDDDGEDEQA
Ga0326726_1194033813300033433Peat SoilVTFHDAFLDARRRIESGADPEEVVPVLLRLAEAQDEIDLAQGLYADGDAEDEDG
Ga0373958_0215140_79_2493300034819Rhizosphere SoilMNTFHDAFLDARRRIESGADPEEVVPILLRLAEADDEIGLAQGLYADDDEPDGEDG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.