NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092467

Metagenome / Metatranscriptome Family F092467

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092467
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 41 residues
Representative Sequence FDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 11.11 %
% of genes near scaffold ends (potentially truncated) 14.95 %
% of genes from short scaffolds (< 2000 bps) 15.89 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (85.981 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(16.822 % of family members)
Environment Ontology (ENVO) Unclassified
(29.907 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.009 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.65%    β-sheet: 0.00%    Coil/Unstructured: 82.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF040292-ph_phosp 10.28
PF01872RibD_C 8.41
PF08281Sigma70_r4_2 5.61
PF13191AAA_16 3.74
PF04542Sigma70_r2 2.80
PF08240ADH_N 2.80
PF069833-dmu-9_3-mt 1.87
PF01575MaoC_dehydratas 1.87
PF04261Dyp_perox 1.87
PF00501AMP-binding 0.93
PF04101Glyco_tran_28_C 0.93
PF02909TetR_C_1 0.93
PF03795YCII 0.93
PF00766ETF_alpha 0.93
PF02801Ketoacyl-synt_C 0.93
PF06831H2TH 0.93
PF00392GntR 0.93
PF08327AHSA1 0.93
PF13189Cytidylate_kin2 0.93
PF00342PGI 0.93
PF02803Thiolase_C 0.93
PF07995GSDH 0.93
PF00004AAA 0.93
PF14489QueF 0.93
PF04828GFA 0.93
PF00542Ribosomal_L12 0.93
PF00082Peptidase_S8 0.93
PF00487FA_desaturase 0.93
PF07883Cupin_2 0.93
PF12697Abhydrolase_6 0.93
PF03605DcuA_DcuB 0.93
PF00565SNase 0.93
PF08808RES 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG2045Phosphosulfolactate phosphohydrolase or related enzymeCoenzyme transport and metabolism [H] 20.56
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 8.41
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 8.41
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.80
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.80
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.80
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.80
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 1.87
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 1.87
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 1.87
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.93
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.93
COG0222Ribosomal protein L7/L12Translation, ribosomal structure and biogenesis [J] 0.93
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.93
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.93
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.93
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.93
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.93
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG2704Anaerobic C4-dicarboxylate transporterCarbohydrate transport and metabolism [G] 0.93
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.93
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.93
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A85.98 %
All OrganismsrootAll Organisms14.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459018|G1P06HT02IHWLGNot Available600Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1058854Not Available510Open in IMG/M
3300005167|Ga0066672_10713707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300005336|Ga0070680_101096917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300005560|Ga0066670_10564538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059695Open in IMG/M
3300005569|Ga0066705_10983963Not Available500Open in IMG/M
3300006852|Ga0075433_11618948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300006904|Ga0075424_101951610All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300011269|Ga0137392_10795168All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012198|Ga0137364_10743218All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300012199|Ga0137383_10978985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300015356|Ga0134073_10246072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300016270|Ga0182036_11518612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300025538|Ga0210132_1002326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2358Open in IMG/M
3300025917|Ga0207660_10971426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300026550|Ga0209474_10226516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300028811|Ga0307292_10102889All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300032075|Ga0310890_11006312All Organisms → cellular organisms → Bacteria671Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Permafrost And Active Layer SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459018Litter degradation MG2EngineeredOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300002028Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L02_012650902170459007Grass SoilALAIVFFDSEDDYDRGDKILSAMPAADTPGQRTSVKKYQVAVRRNP
2MG_015845702170459018Switchgrass, Maize And Mischanthus LitterLVVLFFENEDDYRRGDETLSAMPASDTPGQRTSVTKYNVAMRMSD
AP72_2010_repI_A10DRAFT_105885413300000651Forest SoilVVLFFENEDDYQRGHETLNAMPASDTPGQRTSVSKYNVAMRMSD*
A17_109075423300002028Permafrost And Active Layer SoilDKTLVVVLFENEDDYRKGDEILSAMPKDDTPGRRTSVTKYDVALRQKAG*
Ga0055498_1012927723300004058Natural And Restored WetlandsETEEAYARGDEILDAMPTGDTPGQRTSVSKYDVALRMTT*
Ga0062595_10111088323300004479SoilFDNEDDYRKGDEILNAMPAGDTPGQRTSVKKYDLAMRMSN*
Ga0062595_10128694113300004479SoilENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD*
Ga0062591_10014582813300004643SoilAVIIFDNEDDYKKGDEILSGMPAGDTPGQRTSVTKYNVAMRMKS*
Ga0066672_1071370713300005167SoilPEAEKSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKFNVATRMSN*
Ga0066677_1044005823300005171SoilVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN*
Ga0066688_1047261513300005178SoilVVVFENEDDYKRGDEILSAMPASDTPGSRTSVKKYDVAVHMKP*
Ga0066688_1076656113300005178SoilLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSS*
Ga0070680_10109691713300005336Corn RhizosphereLAIVFFENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD*
Ga0066681_1094400113300005451SoilFENEDDYQKGDEILNAMPAEDTPGRRTSVKKYDVAMRMKS*
Ga0066687_1069394913300005454SoilENEDDYRAGDEILSAMPAGDTSGQRTSVTKYNVATRMSN*
Ga0073909_1033303813300005526Surface SoilEKSIAIVIFDNEDDYKKGDEILGSMPSGDTPGNRTSVAKYNVATRMKS*
Ga0070684_10067822223300005535Corn RhizosphereIVFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS*
Ga0066670_1005779843300005560SoilEKSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN*
Ga0066670_1056453843300005560SoilLFFENEDDYRRGDETLSAMPASDTPGQRTSVAKYNVAMRMSD*
Ga0066705_1040833123300005569SoilAIVIFDNEDDYRKGAEILDAMPGPDTPGQRTSVSKYDVAVRMSS*
Ga0066705_1098396313300005569SoilAIVFFENEDDYQKGHEILDAMPASDTPGQRTAVTKYDVAVRMTN*
Ga0066654_1092166413300005587SoilSLAIVIFDNEDDYRKGDEILGSMPASDTPGTRTSVKKYNVAHRMSM*
Ga0066706_1110564443300005598SoilVIFENEDDYRKGDEILSAMPAGDTPGTRTSVSKHDVALRMKS*
Ga0066706_1113803213300005598SoilIFESDEDYQKGDEALNAMSGEDTPGQRTSVTKHNVAARMKS*
Ga0068858_10240851523300005842Switchgrass RhizosphereFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS*
Ga0066651_1038100423300006031SoilEEDYRKGDEILSAMPAGDVPGQRSSVTKYDVAMRMKS*
Ga0070712_10132419723300006175Corn, Switchgrass And Miscanthus RhizosphereIVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA*
Ga0066659_1109045113300006797SoilEDDYRKADEILSAMPAGDTPGQRTSVTKYNVATRMKP*
Ga0079221_1074610313300006804Agricultural SoilKSIAIVIFDDEDDYARGDEIHSNMPAPETRGQRTSVTTYNVAMRMKS*
Ga0075433_1161894823300006852Populus RhizosphereSEDDYRRGDEVLSAMPAGDTPGQRTGVGKYDVAVRMAV*
Ga0075434_10262992713300006871Populus RhizosphereSEDDYRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN*
Ga0075426_1011495213300006903Populus RhizosphereYRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN*
Ga0075424_10107480313300006904Populus RhizosphereNEDDYKKGDEILSAMPTGDTPGQRTSVSKYNVAVRMKN*
Ga0075424_10195161013300006904Populus RhizosphereAETSTVVVIFDNEDDYRTGDEILNNMDAGDTPGTRTSVKKHDVAMRMSN*
Ga0075424_10200635213300006904Populus RhizosphereSLVLVLFESEDDYRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN*
Ga0079219_1049090823300006954Agricultural SoilEADYQKGHEILDAMPASDTPGRRASVTKYDVAMRMSM*
Ga0105240_1123679023300009093Corn RhizosphereSLAIVIFDNEDDYRKGDEILDSMPASDTPGQRTSVTKYHVAHRMSM*
Ga0066709_10152961423300009137Grasslands SoilFDNEDDYKRGDEILSNMPAADTPGRRTSVQRYDVAARMSS*
Ga0066709_10276122513300009137Grasslands SoilEDDYKKGDEILSAMPAGDTPGQRTSVKKYNVAMRMKS*
Ga0126314_1019968323300010042Serpentine SoilDYTRGDETLNAMSTTDTPGQRTSVKRYDVAMRMAV*
Ga0127456_116180213300010140Grasslands SoilVIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS*
Ga0134088_1024506923300010304Grasslands SoilFETEDDYQRGDEMLSAMPAGETPGKRTSVTKYNVATRMTA*
Ga0134064_1022956013300010325Grasslands SoilVVIFDNEEDYKKGDEILSAMPAGDTPGQRTSVSKYDVAVRMKS*
Ga0134080_1016261733300010333Grasslands SoilDYQKGDEILNAMPAEDTPGRRTSVKKYDVAMRMKS*
Ga0105239_1198000533300010375Corn RhizosphereVIIFDNEDDYKKGDEILSAMPAGDTPGQRTSVTKYDVAMRMKD*
Ga0134123_1083442823300010403Terrestrial SoilFFENEDDYEQGDKTLSAMPAGDTPGQRASVTKYNVAIRMTA*
Ga0137392_1079516813300011269Vadose Zone SoilETEDDYQRGDEALNAMPAGDTPGQRTSVTKYNVATRMTS*
Ga0137364_1074321813300012198Vadose Zone SoilMGGKLVVVFFDDEDAYKRGDEILSSMPTGDTPGQRTSVARYDVAHRQTM*
Ga0137383_1097898513300012199Vadose Zone SoilEAEKSLVVIIFENEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMKS*
Ga0137376_1074103223300012208Vadose Zone SoilSLAIVIFETEDDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS*
Ga0137378_1158113113300012210Vadose Zone SoilNEDDYASADAVLSAMPTDETPGRRTSVAKYNVAMRMKS*
Ga0137377_1060971523300012211Vadose Zone SoilENEDDYRKGDEILDAMPASDTPGQRTSVTKYNVAHRMSM*
Ga0137366_1125323113300012354Vadose Zone SoilTEDDYKRGDEILDAMPAGDTPGRRASVKKYNVATRMTS*
Ga0137371_1125098413300012356Vadose Zone SoilLVVFFDDEDAYQRGDEILSSMPTGDTPGQRTSVSKYDVAVRMTP*
Ga0137375_1086527523300012360Vadose Zone SoilLVIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS*
Ga0137360_1161895713300012361Vadose Zone SoilETEDDYRQADEILNAMPAGETPGQRTSVNRYDVVFRMKS*
Ga0136630_116340013300012529Polar Desert SandDYRRGDEVLSAMPAGETPGQRTSVTKYDVAIRMTP*
Ga0134076_1021486523300012976Grasslands SoilLRKEDDYQRGDEMLSAMPAGETPGKRTSVTKYNVATRMTA*
Ga0120179_100963513300013763PermafrostETEDDYKRGDEILSAMPAGDTPGRRASVTKYNVATRMTP*
Ga0134078_1055475913300014157Grasslands SoilEDDYRKGDELLNAMPAGDTPGQRTSVKKYDVAMRMSN*
Ga0075303_100070313300014299Natural And Restored WetlandsVFFETEDAYARGDEILNAMPTGDTPGQRTSVSKYEVALRMTT*
Ga0163163_1197751313300014325Switchgrass RhizosphereNEDDYRKGDEILSNMPAGDTPGQRTSVTKYNVAMRMKN*
Ga0182006_113915413300015261RhizosphereIFDNEDDYRKGDEILNAMPAGDTPGQRTSVKRYDVAMRMSN*
Ga0134073_1024607223300015356Grasslands SoilVVIIFDNEDDYHAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN*
Ga0132258_1225481813300015371Arabidopsis RhizosphereEDDYRRGNETLDAMPAGETPGQRTSVSKYQVAFRMTS*
Ga0182036_1151861233300016270SoilQALAIVFFDNEDDYQQGHETLDAMPRGDTPGQRTSVTKYNVAMRVTD
Ga0187785_1033262413300017947Tropical PeatlandKSLVVIFFDDHDAYSRGDEILSTMPAGDTPGQRTSVSKYNVAHRQTM
Ga0187776_1025373433300017966Tropical PeatlandFDNEDDYNKGDEILSAMPTDDTPGQRTSVSKYNVAMRMKS
Ga0190272_1050192113300018429SoilDYRRGDETLSAMPAGDTPGQRTSVARYDVAVRMAV
Ga0066667_1211300913300018433Grasslands SoilKSTVVIIFENEDDYKKGDQILNDMPAGDTPGQRTSVSKYNVATRMKN
Ga0066662_1233931013300018468Grasslands SoilEDDYRKGDEILSAMPASDTPGTRTSVTKYNVAMRMKR
Ga0173479_1072979743300019362SoilDYKKGDEILSAMPAGDTPGQRTSVSKYDVAMRMKS
Ga0193730_110530713300020002SoilDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS
Ga0222623_1018165223300022694Groundwater SedimentFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Ga0222622_1093391413300022756Groundwater SedimentADYKTGDETLSAMPAGDTPGKRTSVAKYNVAFRMAD
Ga0247672_106253413300024187SoilNEDDYRKGDEILDSMPASDTPGQRTSVTKYHVAHRMSM
Ga0247667_106714213300024290SoilVFFDDEDKYQRGDEILSAMPAGDTPGQRTSVSKYNVAMRQSM
Ga0210132_100232613300025538Natural And Restored WetlandsEKSLGIVFFETEDAYARGDEILNAMPTGDTPGQRTSVSKYEVALRMTT
Ga0207699_1029692233300025906Corn, Switchgrass And Miscanthus RhizosphereDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Ga0207699_1043653013300025906Corn, Switchgrass And Miscanthus RhizosphereDYKKGDEILGGMPSGDTPGTRTSVTKYNVATHMKS
Ga0207693_1090997113300025915Corn, Switchgrass And Miscanthus RhizosphereIVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA
Ga0207660_1097142633300025917Corn RhizosphereAIVFFENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD
Ga0207664_1137184013300025929Agricultural SoilRSLAIVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA
Ga0207644_1064362823300025931Switchgrass RhizosphereAIVFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS
Ga0207686_1063401933300025934Miscanthus RhizosphereVIIFENEDDYRKGDEILGNMPASDVPGKRTSVTKYDVATRMKS
Ga0207709_1044757323300025935Miscanthus RhizosphereIFENEDDYKKGDEILGSMPTPDTPGTRTSVTKYNVAARMKS
Ga0207703_1221241213300026035Switchgrass RhizosphereFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS
Ga0209239_132596023300026310Grasslands SoilEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN
Ga0209804_131412513300026335SoilIFENEDDYRKGDEILDAMPASDTPGQRTSVTKYNVAHRMSM
Ga0209808_129782913300026523SoilKSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN
Ga0209156_1049438223300026547SoilDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Ga0209474_1022651613300026550SoilFENEDDYRRGDETLNSMPASDTPGQRTSVTKYNVAMRMSD
Ga0209811_1013965333300027821Surface SoilEDDYKKGDEILGSMPSGDTPGNRTSVAKYNVATRMKS
Ga0209811_1035832723300027821Surface SoilEEDYKKGDEILNAMPAGDVPGSRTSVTKYQVATRMKS
Ga0307322_1004272313300028710SoilKSLVIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Ga0307293_1014713043300028711SoilVIFETEDDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS
Ga0307303_1010175223300028713SoilVVIFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS
Ga0307307_1024288513300028718SoilNEDDYRKGDEVLSAMPTDDTPGQRTSVKRYDVAIHRTM
Ga0307315_1028085113300028721SoilFETEDDYKKGDEILNAMPAGDTPGQRTSVMKYDVAMRMKS
Ga0307282_1035732613300028784SoilDDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS
Ga0307292_1010288913300028811SoilDEDYQRGDAALSAMPAGDTPGQRTSVTKYQVAMRMTD
Ga0318546_1126258823300031771SoilDYRRGHEALDAMPAGETPGQRVDVQKYNVAGRMTA
Ga0310893_1026049313300031892SoilNEDDYRKGDEVLSAMPTDDTPGNRTSVQRYDVAIHQTM
Ga0306926_1067748913300031954SoilFENEDDYRRGHEALDAMPAGETPGQRVDVQKYNVAGRMTA
Ga0308173_1000122913300032074SoilVVFDNEEDYRKGDEILSSMPGPDTPGRRASVSKYDVAVRTST
Ga0310890_1100631213300032075SoilDYAKGDAALNAMPASDTPGQRTSVTKYDVAIRMAD
Ga0314865_150688_2_1123300033806PeatlandDDYRKGDAILDAMPGPDTPGRRASVTKYAVAARTAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.