NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092507

Metagenome / Metatranscriptome Family F092507

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092507
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 41 residues
Representative Sequence GTGLGLANVHRRLTAFYGEGVKLRSFPFGTVVRLEVPAA
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 91.59 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (60.748 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.084 % of family members)
Environment Ontology (ENVO) Unclassified
(22.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.860 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.39%    β-sheet: 17.91%    Coil/Unstructured: 59.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF04397LytTR 41.12
PF00072Response_reg 40.19
PF02358Trehalose_PPase 13.08
PF14269Arylsulfotran_2 1.87
PF01925TauE 0.93
PF07228SpoIIE 0.93
PF02518HATPase_c 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 13.08
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A60.75 %
All OrganismsrootAll Organisms39.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002H6C6GNot Available509Open in IMG/M
2170459012|GOYVCMS01ARKM3Not Available501Open in IMG/M
2170459020|G1P06HT01BMFAZNot Available516Open in IMG/M
2189573001|GZR05M102IYEZ2Not Available510Open in IMG/M
3300001431|F14TB_100047695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia666Open in IMG/M
3300005439|Ga0070711_100230220All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300005447|Ga0066689_10868931All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005467|Ga0070706_101622578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia590Open in IMG/M
3300005533|Ga0070734_10522010All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005539|Ga0068853_101017422All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005539|Ga0068853_101958336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia568Open in IMG/M
3300005540|Ga0066697_10111356All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300005547|Ga0070693_101438054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia537Open in IMG/M
3300005560|Ga0066670_10829173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes561Open in IMG/M
3300006058|Ga0075432_10525090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfitobacterium531Open in IMG/M
3300006175|Ga0070712_100090738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2237Open in IMG/M
3300006175|Ga0070712_100461130All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300006358|Ga0068871_100421372All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300006755|Ga0079222_10297548All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300006791|Ga0066653_10212025All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300006794|Ga0066658_10369594All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300006796|Ga0066665_10216003All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300006806|Ga0079220_10119355All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300006871|Ga0075434_101436910Not Available699Open in IMG/M
3300006903|Ga0075426_10894547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes669Open in IMG/M
3300006904|Ga0075424_101396497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes744Open in IMG/M
3300006954|Ga0079219_10695200All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006954|Ga0079219_10906697All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300007076|Ga0075435_100439726All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300009038|Ga0099829_11269263Not Available609Open in IMG/M
3300009147|Ga0114129_11443020Not Available848Open in IMG/M
3300009162|Ga0075423_10380150All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300009162|Ga0075423_11388067Not Available752Open in IMG/M
3300009174|Ga0105241_10142621All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300009789|Ga0126307_10109304Not Available2196Open in IMG/M
3300010041|Ga0126312_10376020Not Available1008Open in IMG/M
3300010041|Ga0126312_11033150Not Available602Open in IMG/M
3300010320|Ga0134109_10236706Not Available684Open in IMG/M
3300010337|Ga0134062_10344568Not Available716Open in IMG/M
3300010362|Ga0126377_11882322Not Available674Open in IMG/M
3300010396|Ga0134126_11550452Not Available729Open in IMG/M
3300010401|Ga0134121_10481701All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300011987|Ga0120164_1036478Not Available738Open in IMG/M
3300012198|Ga0137364_10784618Not Available720Open in IMG/M
3300012209|Ga0137379_11650918Not Available538Open in IMG/M
3300012937|Ga0162653_100039200Not Available709Open in IMG/M
3300012951|Ga0164300_10272945Not Available870Open in IMG/M
3300012951|Ga0164300_10955776Not Available547Open in IMG/M
3300012961|Ga0164302_11441906Not Available564Open in IMG/M
3300012977|Ga0134087_10563588All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012977|Ga0134087_10776910Not Available516Open in IMG/M
3300012987|Ga0164307_10364421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300012987|Ga0164307_10994903Not Available682Open in IMG/M
3300012989|Ga0164305_11104794Not Available681Open in IMG/M
3300013104|Ga0157370_10751809Not Available888Open in IMG/M
3300013308|Ga0157375_13665563Not Available511Open in IMG/M
3300013503|Ga0120127_10079471Not Available705Open in IMG/M
3300014498|Ga0182019_11230656Not Available551Open in IMG/M
3300015373|Ga0132257_100738183Not Available1225Open in IMG/M
3300015373|Ga0132257_103013597Not Available614Open in IMG/M
3300017961|Ga0187778_11120923Not Available549Open in IMG/M
3300018072|Ga0184635_10291391Not Available641Open in IMG/M
3300018433|Ga0066667_11961491Not Available536Open in IMG/M
3300020081|Ga0206354_10489850Not Available511Open in IMG/M
3300020082|Ga0206353_11861837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2607Open in IMG/M
3300022756|Ga0222622_10029678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2900Open in IMG/M
3300025898|Ga0207692_10126268All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300025912|Ga0207707_10240957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1572Open in IMG/M
3300025912|Ga0207707_11186902Not Available618Open in IMG/M
3300025917|Ga0207660_10558247Not Available931Open in IMG/M
3300025917|Ga0207660_10578704Not Available914Open in IMG/M
3300025920|Ga0207649_11664828Not Available505Open in IMG/M
3300025934|Ga0207686_10960257Not Available692Open in IMG/M
3300025961|Ga0207712_11549382Not Available594Open in IMG/M
3300026078|Ga0207702_11638986Not Available636Open in IMG/M
3300026095|Ga0207676_11995748Not Available579Open in IMG/M
3300026306|Ga0209468_1083750All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300026326|Ga0209801_1093593All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300027775|Ga0209177_10200611Not Available710Open in IMG/M
3300027787|Ga0209074_10125785Not Available896Open in IMG/M
3300027873|Ga0209814_10006448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4517Open in IMG/M
3300028577|Ga0265318_10346783Not Available542Open in IMG/M
3300028755|Ga0307316_10112869Not Available954Open in IMG/M
3300028793|Ga0307299_10329201Not Available573Open in IMG/M
3300028811|Ga0307292_10283900Not Available691Open in IMG/M
3300028811|Ga0307292_10319447Not Available652Open in IMG/M
3300028872|Ga0307314_10255980Not Available545Open in IMG/M
3300028881|Ga0307277_10403030Not Available612Open in IMG/M
3300031235|Ga0265330_10272413Not Available713Open in IMG/M
3300031716|Ga0310813_10467688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1097Open in IMG/M
3300031720|Ga0307469_11010856Not Available777Open in IMG/M
3300031747|Ga0318502_10833941Not Available559Open in IMG/M
3300031770|Ga0318521_10323224Not Available911Open in IMG/M
3300031938|Ga0308175_101396494Not Available781Open in IMG/M
3300031939|Ga0308174_11672671Not Available547Open in IMG/M
3300031996|Ga0308176_10431896All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300032005|Ga0307411_12118441Not Available526Open in IMG/M
3300032068|Ga0318553_10051828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2022Open in IMG/M
3300032180|Ga0307471_102760869Not Available623Open in IMG/M
3300032180|Ga0307471_103892999Not Available528Open in IMG/M
3300032770|Ga0335085_10191289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2516Open in IMG/M
3300032829|Ga0335070_10364217All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300032898|Ga0335072_10778098Not Available920Open in IMG/M
3300032954|Ga0335083_10101630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2831Open in IMG/M
3300033004|Ga0335084_12075519Not Available553Open in IMG/M
3300034195|Ga0370501_0404392Not Available500Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.08%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
2170459020Litter degradation NP2EngineeredOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011987Permafrost microbial communities from Nunavut, Canada - A20_80cm_0MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_064224302170459003Grass SoilLESGVGEGTGLGLANVNQRLVAHYGESVHLRSFPFGTVVRLSVPVA
N56_031070802170459012Grass SoilGLGLANVNQRLIAHYGESVRLRSFPFGTVVRLEVPVAR
2NP_009002802170459020Switchgrass, Maize And Mischanthus LitterPGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTIVRLEVPT
FD2_059920802189573001Grass SoilPGFGEGTGLGLANVNLRLTAHYGEGVQLRSFPFGTVVRMDVPAT
F14TB_10004769513300001431SoilVGEGDGVGLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLNVPAE*
Ga0070711_10023022013300005439Corn, Switchgrass And Miscanthus RhizospherePGVGEGDGAGLGLANVHQRLTTFYGEGVRLKSGAFGTVVRLHVPAE*
Ga0066689_1086893123300005447SoilHAGTGLGLASVHHRLTAFYGEGVKLRSFPFGTVVRLEVPVS*
Ga0070706_10162257813300005467Corn, Switchgrass And Miscanthus RhizosphereGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLEVPLG*
Ga0070734_1052201023300005533Surface SoilVGDGTGIGLANVDRRLTAHYGAGVRLRSFPFGTVVRLEVPAS*
Ga0068853_10101742223300005539Corn RhizosphereGEGTGLGLANVNMRLVAHYGESVQLRSFPFGTVVRLRVPVA*
Ga0068853_10195833623300005539Corn RhizosphereEQGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLEVPLG*
Ga0066697_1011135613300005540SoilAGLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPV*
Ga0070693_10143805413300005547Corn, Switchgrass And Miscanthus RhizosphereVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLEVPLG*
Ga0066670_1082917313300005560SoilGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPVE*
Ga0075432_1052509013300006058Populus RhizosphereGVGDGTGLGLANVNLRLTAHYGAGVRLRSFPFGTIVRLEVPTAR*
Ga0070712_10009073853300006175Corn, Switchgrass And Miscanthus RhizosphereDGAGLGLANVHGRLTAFYGEGVRLKSGGFGTVVTLDVPAG*
Ga0070712_10046113033300006175Corn, Switchgrass And Miscanthus RhizosphereEGTGLGLANVNRRLVAHYGEEVRLRSFPFGTVVRLEVPIA*
Ga0068871_10042137233300006358Miscanthus RhizosphereLANVNLRLTAHYGEGVRLRSFPFGTVVRLDVPASSEPS*
Ga0079222_1029754813300006755Agricultural SoilEPGVGEGTGLGLANVNRLLTAHYGEGVRLRSFPFGTVVRLEVPAA*
Ga0066653_1021202533300006791SoilGDGAGLGLANVHRRLTAFYGEGVRLKSGGFGTVVRLDVPAS*
Ga0066658_1036959423300006794SoilGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTIVRLEVPTAP*
Ga0066665_1021600313300006796SoilLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPVGH*
Ga0079220_1011935533300006806Agricultural SoilGLANVHQRLTAFYGEGARLKSGGFGTVVRLDVPAE*
Ga0075434_10143691023300006871Populus RhizosphereLANVHQRLTAFYGEGVRLKSGGFGTIVRLQVPAG*
Ga0075426_1089454723300006903Populus RhizosphereGDGAGLGLANVHQRLTAFYGEGVRLKSGGFGTIVRLQVPAG*
Ga0075424_10139649713300006904Populus RhizosphereESDGLGLANVHGRLTAFYGEGVRLKSGVFGTVVRLQVPAA*
Ga0079219_1069520023300006954Agricultural SoilGVGEGTGLGLANVNTRLTAHYGEGVRLRSFPFGTVVRLEVPAA*
Ga0079219_1090669713300006954Agricultural SoilDGTGVGLANVNRRLQVHYGGGVRLRSFPFGTVVRLEVPAA*
Ga0075435_10043972613300007076Populus RhizosphereEGEGTGLGLASVNHRLTVFYGEGVKLRSFPFGTVVRLEVPVS*
Ga0099829_1126926323300009038Vadose Zone SoilVGLANVNRRLQAHYGEGVKLRSFPFGTIVRLEVPAA*
Ga0114129_1144302013300009147Populus RhizosphereGLGLASVNHRLTVFYGEGVKLRSFPFGTVVRLEVPVS*
Ga0075423_1038015013300009162Populus RhizospherePGVSEGDGTGLGLAGVHRRLTAVYGRGVRLRSSSIGTVVRLEVPVS*
Ga0075423_1138806713300009162Populus RhizospherePGTSESDGLGLANVHGRLTAFYGEGVRLKSGVFGTVVRLQVPA*
Ga0105241_1014262113300009174Corn RhizosphereLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLEVPLG*
Ga0126307_1010930433300009789Serpentine SoilGDSAGTGLGLANVHRRLTAFYGEGVKLRSFPFGTVVRLEVPAA*
Ga0126312_1037602033300010041Serpentine SoilGTGLGLANVHRRLTAFYGEGVKLRSFPFGTVVRLEVPAA*
Ga0126312_1103315023300010041Serpentine SoilSLGESAGTGLGLANVHHRLTAFYGEGVKLRSFPFGTVVRLEVPAA*
Ga0134109_1023670613300010320Grasslands SoilPGVGEGDGAGLGLANVHRRLTAFYGAGVRLKSGGFGTVVRLEVPAA*
Ga0134062_1034456823300010337Grasslands SoilARLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPV*
Ga0126377_1188232213300010362Tropical Forest SoilLGLASVHHRLQAFYGEGVKLRSFPFGTVVRLEVPVS*
Ga0134126_1155045223300010396Terrestrial SoilGTGLGLASVHHRLTAFYGEGVKLRSFPFGTVVRLEVPVA*
Ga0134121_1048170113300010401Terrestrial SoilGVGEGTGLGLANVHLRLNAHYGEGVRLRSFPFGTIVRLEVPTAQ*
Ga0120164_103647823300011987PermafrostMLGQLADEVGGEGTGLGLANVNLRLTAHYGKGVKLRSFPFGTVVRLEVPLG*
Ga0137364_1078461823300012198Vadose Zone SoilGDGAGLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPVE*
Ga0137379_1165091823300012209Vadose Zone SoilLSNVHGRLTAFYGEGVRLKSGGFGTVVRLDVPAG*
Ga0162653_10003920023300012937SoilGESNGLGLANVHGRLTAFYGEGVRLKSGVFGTVVRLQVPAA*
Ga0164300_1027294523300012951SoilEGTGLGLANVHLRLNAHYGEGVRLRSFPFGTIVRLEVPTAQ*
Ga0164300_1095577623300012951SoilEGTGLGLANVNRLLTAHYGAGVRLRSFPFGTVVRLEVPTA*
Ga0164302_1144190623300012961SoilGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLDVPASSEPS*
Ga0134087_1056358813300012977Grasslands SoilGTGLGLANVNRRLTAHYGESVRLRSFPFGTVVRLEVPAA*
Ga0134087_1077691013300012977Grasslands SoilGAGLGLANVHRRVTAFYGEGVRLKSGGFGTVVRLDVPAA*
Ga0164307_1036442113300012987SoilGLANVNRLLTAHYGEGVRLRSFPFGTVVRLEVPAA*
Ga0164307_1099490323300012987SoilDGTGLGLANVNRRLQAHYGAGVRLRSFPFGTVVRLEVPAG*
Ga0164305_1110479423300012989SoilGLANVHGRLTAFYGEGVRLKSGGFGTVVRLDVPAG*
Ga0157370_1075180913300013104Corn RhizosphereGLANVNMRLVAHYGESVQLRSFPFGTVVRLQVPVA*
Ga0157375_1366556313300013308Miscanthus RhizosphereLGLANVDRRLRAFYGEGVRLKSGAFGTVVRLHVPAE*
Ga0120127_1007947123300013503PermafrostGLGLANVNRRLTAHYGEGVRLRSFPFGTVVRLEVPV*
Ga0182019_1123065623300014498FenMGLGLANVHGRLTAHYGEGVKLRSFPFGTVARLEVPVSEDDA*
Ga0132257_10073818323300015373Arabidopsis RhizosphereGTGLGLASVHRRLRAAYGEGVKLRSSPIGTVVRLQVPVG*
Ga0132257_10301359723300015373Arabidopsis RhizosphereLEPGVGEGTGLGLANVNRLLTAHYGAGVRLRSFPFGTVVRLEVPTA*
Ga0187778_1112092323300017961Tropical PeatlandDGTGLGLASVHRRLTAFYGEGVRLRSFPFGTVVRLAVPVS
Ga0184635_1029139113300018072Groundwater SedimentGLANVHGRLTAFYGEGVRLKSGVFGTVVRLQVPAA
Ga0066667_1196149123300018433Grasslands SoilGLGLANVHPRLTAFYGEGVRLKSGGFGTVVRLDVPVE
Ga0206354_1048985013300020081Corn, Switchgrass And Miscanthus RhizosphereGTGLGLANVNLRLTAHYGAGVRLRSFPFGTVVRLEVPLG
Ga0206353_1186183753300020082Corn, Switchgrass And Miscanthus RhizosphereLEPGVGEGTGIGLANVNLRLTAHYGEGVKLRSFPFGTIVMLEVPE
Ga0222622_1002967863300022756Groundwater SedimentEDGLGLANVHQRLTAFYGEGVRLKSGVFGTVVRLQVPA
Ga0207692_1012626813300025898Corn, Switchgrass And Miscanthus RhizosphereGLGLANVHQRLTAFYGEGVRLKSGGFGTIVRLQVPAG
Ga0207707_1024095713300025912Corn RhizospherePGVGEGTGIGLANVNLRLTAHYGEGVKLRSFPFGTIVMLEVPE
Ga0207707_1118690223300025912Corn RhizosphereLEAGVGEGTGLGLANVNMRLVAHYGESVQLRSFPFGTVVRLRVPVA
Ga0207660_1055824723300025917Corn RhizosphereEGDGAGLGLANVHQRLTAFYGEGVRLKSGGFGTIVRLQVPADEASLAMPI
Ga0207660_1057870433300025917Corn RhizosphereGTGIGLANVNLRLTAHYGEGVKLRSFPFGTVVRLEVPAVPV
Ga0207649_1166482813300025920Corn RhizosphereGVGEGTGIGLANVNLRLTAHYGEGVKLRSFPFGTVVRLEVPE
Ga0207686_1096025723300025934Miscanthus RhizosphereGAGLGLANVHQRLTAFYGEGVRLKSGGFGTIVRLQVPAG
Ga0207712_1154938213300025961Switchgrass RhizosphereGEGDGPGLGLANVHQRLTTFYGEGVRLKSGGFGTVVRLHVPAE
Ga0207702_1163898613300026078Corn RhizosphereEGTGIGLANVNLRLTAHYGEGVKLRSFPFGTVVRLEVPE
Ga0207676_1199574823300026095Switchgrass RhizosphereGVGGGMGLGLASVDLRLKAHYGEGVRLRSSPLGTVVRLAVPVE
Ga0209468_108375033300026306SoilGDGAGLGLANVHRRLTAFYGEGVRLKSGGFGTVVRLDVPAS
Ga0209801_109359333300026326SoilLGLANVHQRLTAFYGEGVRLKSGGFGTVVRLDVPVE
Ga0209177_1020061123300027775Agricultural SoilDGTGVGLANVNRRLQVHYGGGVRLRSFPFGTVVRLEVPAA
Ga0209074_1012578513300027787Agricultural SoilGEGTGLGLANVNRLLTAHYGEGVRLRSFPFGTVVRLEVPAA
Ga0209814_1000644813300027873Populus RhizosphereEGDGAGLGLANVHRRLTAFYGEGVRLKSGGFGTVVRLEVPAA
Ga0265318_1034678323300028577RhizosphereLGLANVHGRLTAHYGEGVKLRSFPFGTVARLEVPVSEDDA
Ga0307316_1011286933300028755SoilGEGDGAGLGLANVHQRLTTFYGEGVRLKSGAFGTVVRLHVPVE
Ga0307299_1032920123300028793SoilEPGVGEGTGLGLANVNRLLTAHYGAGVQLRSFPFGTVVRLEVPTA
Ga0307292_1028390013300028811SoilPGVGEGNGVGLGLANVNQRLTAFYGEGVRLKSGGFGTVVRLDVPAA
Ga0307292_1031944713300028811SoilLGLANVHQRLTTFYGEGVRLKSGGFGTVVRLNVPAE
Ga0307314_1025598013300028872SoilGESNGLGLANVHGRLTAFYGEGVRLKSGVFGTVVRLQVPAA
Ga0307289_1012194213300028875SoilEPGVGEGNGVGLGLANVNQRLTAFYGEGVRLKSGGFGTVVRLDVPAA
Ga0307277_1040303023300028881SoilGVGSADGAGLGLANVHRRLTAFYGEGVRLKSGAFGTVVRLEVPA
Ga0265330_1027241313300031235RhizosphereVGVGDGTGLGLANVNQRLIAHYGESVRLRSFPFGTVVRLEVPVA
Ga0310813_1046768833300031716SoilAGTGLGLASVHHRLTAFYGEGVKLRSFPFGTVVRLEVPVA
Ga0307469_1101085623300031720Hardwood Forest SoilGVSEREGTGLGLASVHHRLNAFYGEGVKLRSFPFGTVVRLEVPVS
Ga0318502_1083394123300031747SoilTGVGLANVHRRLEAHYGSGVRLRSFPFGTVVRLEVPAA
Ga0318521_1032322413300031770SoilLEPGVGEGTGLGLANVNRRLTAHYGEGVKLRSFPFGTVVRMEVPAA
Ga0308175_10139649423300031938SoilPGVGGGDGAGLGLANVHRRLTAFYGEGVRLKSGGFGTVVRLDVPA
Ga0308174_1167267113300031939SoilTGLGLANVHRLLTAHYGEGVRLRSFPFGTVVMLEVPV
Ga0308176_1043189613300031996SoilGAGLGLANVHRRLTAFYGEGVRLKSGGFGTVVRLDVPA
Ga0307411_1211844113300032005RhizosphereESAGTGLGLANVHHRLTAFYGEGVKLRSFPFGTVVRLEVPAA
Ga0318553_1005182813300032068SoilFGDGTGVGLANVQLRLAAHYGSGVRLRSSPLGTIVSLEVPVA
Ga0307471_10276086923300032180Hardwood Forest SoilPGVSEREGTGLGLASVNHRLTAFYGEGVRLRSFPFGTVVRLEVPTS
Ga0307471_10389299913300032180Hardwood Forest SoilEPGVSEGEGTGLGLASVNHRLTVFYGEGVKLRSFPFGTVVRLEVPVS
Ga0335085_1019128913300032770SoilTGVGLANVQLRLEAHYGSGVRLRSSPLGTVVSLEVPAA
Ga0335070_1036421713300032829SoilTGLGLANVDRRLTAHYGEGVRLRSFPFGTVVRLEVPIG
Ga0335072_1077809813300032898SoilAGTGLGLASVDGRLTAFYGQGVRLRSFPFGTVVRLEVPV
Ga0335083_1010163073300032954SoilGVGEGTGLGLANVNLRLTAHYGEGVRLRSFPFGTVVRLEVPV
Ga0335084_1207551913300033004SoilLGLANVHLRLTAHYGEGVRLRSFPFGTVVRLEVPVA
Ga0370501_0404392_363_4913300034195Untreated Peat SoilVGEGTGLGLANVNRRLIAHYGESVRLRSFPFGTVVRLEVPVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.