NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093094

Metagenome / Metatranscriptome Family F093094

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093094
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 156 residues
Representative Sequence MNVIAPRCKSAMDNLTRNLSPKFMTIKTAASLLKRNWPAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNVREVLVHTCFDEEVRIKCSSFDEASVLEDGAALSFMIISQVEVRCIFRINLYDLGLRFGLHL
Number of Associated Samples 77
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 48.08 %
% of genes near scaffold ends (potentially truncated) 84.91 %
% of genes from short scaffolds (< 2000 bps) 98.11 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.226 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(72.642 % of family members)
Environment Ontology (ENVO) Unclassified
(89.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(80.189 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.64%    β-sheet: 26.98%    Coil/Unstructured: 61.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.23 %
UnclassifiedrootN/A3.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005335|Ga0070666_11185896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza569Open in IMG/M
3300005353|Ga0070669_101961061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300005438|Ga0070701_10271616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1032Open in IMG/M
3300009553|Ga0105249_13083663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300009972|Ga0105137_104918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum640Open in IMG/M
3300009972|Ga0105137_110116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza517Open in IMG/M
3300009981|Ga0105133_102197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1050Open in IMG/M
3300009989|Ga0105131_142817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300009990|Ga0105132_126676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300009992|Ga0105120_1032465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica624Open in IMG/M
3300010396|Ga0134126_11409636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica770Open in IMG/M
3300010396|Ga0134126_13062277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300010397|Ga0134124_12654271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza544Open in IMG/M
3300010400|Ga0134122_11152328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum772Open in IMG/M
3300010403|Ga0134123_11451183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza728Open in IMG/M
3300012949|Ga0153798_10273068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015278|Ga0182099_1061315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015278|Ga0182099_1072037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza507Open in IMG/M
3300015280|Ga0182100_1087666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015284|Ga0182101_1008588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1070Open in IMG/M
3300015284|Ga0182101_1055102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300015290|Ga0182105_1072134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015290|Ga0182105_1089494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015297|Ga0182104_1052743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum674Open in IMG/M
3300015297|Ga0182104_1120532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300015306|Ga0182180_1046940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300015306|Ga0182180_1047994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza641Open in IMG/M
3300015311|Ga0182182_1022736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum887Open in IMG/M
3300015311|Ga0182182_1066067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza628Open in IMG/M
3300015315|Ga0182120_1027378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza901Open in IMG/M
3300015315|Ga0182120_1058388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza700Open in IMG/M
3300015316|Ga0182121_1094472All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300015316|Ga0182121_1117896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza550Open in IMG/M
3300015318|Ga0182181_1079608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300015318|Ga0182181_1105177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300015319|Ga0182130_1036158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300015319|Ga0182130_1105383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015320|Ga0182165_1053031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum742Open in IMG/M
3300015324|Ga0182134_1084661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300015325|Ga0182148_1074867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015325|Ga0182148_1134647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015325|Ga0182148_1136783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015326|Ga0182166_1126523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015326|Ga0182166_1141629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015327|Ga0182114_1145283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015328|Ga0182153_1140922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300015329|Ga0182135_1067784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300015329|Ga0182135_1090257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015330|Ga0182152_1102243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica594Open in IMG/M
3300015331|Ga0182131_1042472Not Available821Open in IMG/M
3300015331|Ga0182131_1127618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza546Open in IMG/M
3300015332|Ga0182117_1088858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum662Open in IMG/M
3300015333|Ga0182147_1055260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum782Open in IMG/M
3300015333|Ga0182147_1073689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum704Open in IMG/M
3300015334|Ga0182132_1161936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015338|Ga0182137_1124357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015340|Ga0182133_1073970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum748Open in IMG/M
3300015340|Ga0182133_1119758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300015348|Ga0182115_1196799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza646Open in IMG/M
3300015348|Ga0182115_1285568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300015349|Ga0182185_1156739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300015349|Ga0182185_1242502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015350|Ga0182163_1082389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum957Open in IMG/M
3300015352|Ga0182169_1223437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015352|Ga0182169_1230930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015352|Ga0182169_1257279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300015353|Ga0182179_1228293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015354|Ga0182167_1257193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica628Open in IMG/M
3300017408|Ga0182197_1024184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum999Open in IMG/M
3300017412|Ga0182199_1185613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300017414|Ga0182195_1085475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum733Open in IMG/M
3300017421|Ga0182213_1248490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300017422|Ga0182201_1092741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300017435|Ga0182194_1069349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300017435|Ga0182194_1088522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum620Open in IMG/M
3300017439|Ga0182200_1059498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300017439|Ga0182200_1102287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300017440|Ga0182214_1085460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum661Open in IMG/M
3300017447|Ga0182215_1156585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica527Open in IMG/M
3300017691|Ga0182212_1169274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300017693|Ga0182216_1206373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum520Open in IMG/M
3300017694|Ga0182211_1087037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum727Open in IMG/M
3300026035|Ga0207703_11631513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza620Open in IMG/M
3300028049|Ga0268322_1051832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300028056|Ga0268330_1030685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza650Open in IMG/M
3300028056|Ga0268330_1053706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300028061|Ga0268314_1029466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300028140|Ga0268334_1011397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300028256|Ga0268304_1000426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1643Open in IMG/M
3300028262|Ga0268310_1037630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300028380|Ga0268265_10730148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza960Open in IMG/M
3300028472|Ga0268315_1013796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300028473|Ga0268319_1007680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300028474|Ga0268331_1014679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028529|Ga0268311_1013393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300032502|Ga0214490_1111470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300032502|Ga0214490_1146017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza534Open in IMG/M
3300032550|Ga0321340_1058066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300032625|Ga0214501_1275890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300032689|Ga0214497_1082519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300032761|Ga0314733_1069132Not Available675Open in IMG/M
3300032824|Ga0314735_1027828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza1043Open in IMG/M
3300033530|Ga0314760_1076226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum831Open in IMG/M
3300033534|Ga0314757_1086734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere72.64%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere10.38%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated5.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070666_1118589613300005335Switchgrass RhizosphereMNVIAPRCKSAMDNLTRNLSPKFMTIKTAASLLKRNWPAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNVREVLVHTCFDEEVRIKCSSFDEASVLEDGAALSFMIISQVEVRCIFRINLYDLGLRFGLHL
Ga0070669_10196106113300005353Switchgrass RhizosphereVHQLKSWIMNIAALRCELAMDNLTRNPAPKLMTIKTSASLVERNWPAFVEIEVAGKSFPRKQIFFPKKSKINPIFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNIREVFVHTYFDEEIRIECSGVDEASVLEDGVALSFMIISQVEVRCIFRINLYDLGLRFGLHLF
Ga0070701_1027161623300005438Corn, Switchgrass And Miscanthus RhizosphereMNITASRCELAIDNLTRNSTSKFMTIKTSASVVERNRPAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTVLLNGNEVIPSNSMPNVREVFVHTCFDEEIWIECSGVDEALVLEDGVALVFMIISQVEVGGILCINL
Ga0105249_1308366313300009553Switchgrass RhizosphereMNIVAPRCKLAMDNLTRNLAPKFMTIKTAASLLKRNWPAFVEIEVAGKSFPRKQIFFPKNSKINPVFHLLKSAKKLDGEESRTVLLNGNEVIPSNFVPNIREVFVHTYFDEEVQIKCSGVDEASVLVDGVALSFTIISQ
Ga0105137_10491813300009972Switchgrass AssociatedNLAPKLMTIKTAVSFLKRNWPAFVEIEVASKSFPRKQILFPKKIKKNHVFHLPKSAKKFDGEESRTILLNGNEVIPSNFMPNIREVFVHTYFDEEVRIEGSGVDEALVLDDGIALSFTGITQVEVGSVIFINFYGLGLWFGLHLFVLFFLFVVHHAWCGRRFGCVRA*
Ga0105137_11011613300009972Switchgrass AssociatedMNIIAPRCKHAMENLTRNLAPKFMTIKTAASLIERNQPAFVEIEVAGKIFPRKQILLPEKSKINPIFHLLKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTCFDEEVRIDCSGVDEASVLEDGIALAFTIISQVEVGGIFCINLYSLG
Ga0105133_10219713300009981Switchgrass AssociatedASLVQRNRLAFVEIEVASKSFPRKQIFFPEKSKINLVFHLPKSAKKLDGEESRTILLNGDEVIPSNCMPNVREVFVHTCFDEEIRIERSGQDEDSVLDDGVALSFTIISQVEVWCIFRINLYDPSLRFGLHLFILFFFLVVHGAWCRRRLGCV*
Ga0105131_14281713300009989Switchgrass AssociatedMDITAPRCKLAMDNLTQNLAPKLMTIKTTASLLKGNWLAFVEIKVASKSFPRKQIFFPKKSKVNPIFHLPKSAKTLDGEELRTILLNRNEVIPSNCMPNISEVFVHTYFEEEFRIEGSGVDEASVLDDGIGLSFTSVAQVDVG
Ga0105132_12667613300009990Switchgrass AssociatedMNVIAPRCKSAMDNLTRNLLPKFMTIKTVASLLKRNRPAFVEIKVASKSFPRKQIVLPEKSKINPIFHLPKSAKKLDGEEPRIVLLNGNKVVPSNCVPNISEVFIRTCFDEEFRIEGSGVDGASVLEDGVALSFTIVAQVEIGRVIFINFHGLGLWYGLHF
Ga0105120_103246513300009992Switchgrass AssociatedMNVNAPRCKSAMDNLTRNLSPKFMMIKTAASLLKRNWPAFVEIEVASKSFPRKQIFFLEKSKVNPIFHLPKSAKKLDGEEPRTVLLNGNEVVPSNCVPNISKVFVHTCFDEEFRIEGSGVDEALVLDDGIALSFTSIVQVEVGSVIFINFHGLGLHLFILFFLFLVHHARAWRRF
Ga0134126_1140963613300010396Terrestrial SoilMNVAAPRCELAMDNLTRNLAPKLMTIKTTASLLQRNWPAFVEIEVASKSFLRKQIFLPEKSKINPIFHLPKSAKKLDGEEPRTVLLNGSEVAPSNCVPNISEVFVHTCFDLEFQIEGSGVDEASVLDGGVGLSLTSIA*
Ga0134126_1306227713300010396Terrestrial SoilLAMDNLTRNLAPKFITIKTTAILLERNWPAFAEIEVAGKSFPKKKIFFPKKSKIDPVFHLPKSAKKLDGEESRTILLNGNEIIPSNCMPNIREVFVHTCFDEEVRIESSGVDKASILEDGVALSFTIISQVEVRCIFRINLYDSGLRFGLHLFVLFFFFIVHRAWCRR
Ga0134124_1265427113300010397Terrestrial SoilMTIKTAASLLKRNWPAFVEIEVAGKSVPRKQIFFPEKSKVNPIFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNIREVLVHTCFDEEVRIKCSGLDEASVLEDGAALLFMIISQVEVRCIFRINLYDLGLRF
Ga0134122_1115232823300010400Terrestrial SoilMNIAAPRCKLAMDNLTRNPAPKLMMIKSSASFFQRNWPVFVEIEVAGKSFPRKQILFPKKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVRKVFVHTCFDEEVRIECSGVDEASVLEDSVALSFTIISQVEV*
Ga0134123_1145118313300010403Terrestrial SoilMTIKTLASLVQRNRPAFVEIEVAGKSFPRKQIFFPENSKVNPIFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTCFDEEVWIECSGVDEASVLEDGVALSFTIISQVEVRCIFRINLYDLGLHLFVLFFFLVVHRAWCRRRFGCVRA*
Ga0153798_1027306823300012949Switchgrass DegradingMTIKTSASLVERNRPAFVEIEVAGKSFPRKQIFFPEKSKVNSVFHLPKSAKKLDGEESRTILLNRNGVMPSNCMPNIREVFVHTCFDEEVRIEGSGVDEASILEDGVALSFTIISQVEVRCIFRINLYDPGLWLGLHLFILFFFLIVQCAWHRCRF
Ga0182099_106131513300015278Switchgrass PhyllosphereTRNLAPKFMMIKTAASLLKRNWPAFVEIEVAGKGFPRKQIFFPENSKINPVFHLPKSAKKLDGEESRTILLNGNEIIPSNCMPNIREVFVHICFDEEVRIECSGVDEASVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVYRVWCRRRFGCV*
Ga0182099_107203723300015278Switchgrass PhyllosphereMTIKISASLVERNRPAFVEIEVAGKSFPRKQIFFPKKLKVNPIFHLPKSAKKLDGEESRTILLNRNEVIPSNFVPNVREVFVHTYFDEEVRIECSGVDEASVLEDGVALSFTIISQVEVQCIFSINLYDPGLRF
Ga0182100_108766613300015280Switchgrass PhyllosphereMTIKTAASLLKRNWPAFVEIEVAVKIFLKKQIILPEKSKINPVFHLLKSAKKLDGEESRTILINGNEIIPSNCMPNVREVFVHTYFDEEVWIECLAFMIISQVEVGGIFCINLYGLGLRFGLHLF
Ga0182101_100858813300015284Switchgrass PhyllosphereMTIKTAASLIERNRSAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNIREVFVHTCFDEEVRIECSGVDEASVLEDGIALLFTIISQVEVRCIFRINLYDLSLRFGLHLFILFFFLIVHRAW
Ga0182101_105510213300015284Switchgrass PhyllosphereMNIIAPRCKLALDNLSRNLAPKFMTIKTAASLLKRNWPVFVELEVAGKSFSRKQILFPEKSKINTVFHLPKCAKKLDGEESRTILLNGNEIIPSNSMPNVREVFVHTCFGDEVRIECSGVDETSVFEDGVALTFTIISQVKIGSIFCVNLYGLGLHLFILFFFL
Ga0182105_107213413300015290Switchgrass PhyllosphereSLVQRNRLAFVEIEVADKSFPRKQIFFPEKSEINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFVSNVREVFVHTCFDEEVRIESSGVDEASVLEDGATLSFMSVSQVEVGSVIFINFHGLGLRFGLHLFVLSFLFILLIVHCGRCWCWFGGMTRA*
Ga0182105_108949413300015290Switchgrass PhyllosphereMNIAAPRCKLAMDNLTRNLALKLMTIKTATSLLKRNWPAFVELEVAGKSFSRKQILFPEKSKINTIFHLPKCAKKLDGEKSRTILLNGNEVIPSNFMPNIREVFIHTYFDEEVRIEGSGVDETSVLEDGVALSFTIIPQVEVQFIFYINLYDSDLR
Ga0182104_105274313300015297Switchgrass PhyllosphereMNIAAPRCELAMDNLTRNLAPKFMTIKTAASLIKRNHPAFVQIEVIGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTVLLHGNEVIPSNCMPNVREVFVHTCFDKEVRIECSGVDKASVLEDGVALSFTIIPQVEVRCIFRINLYD
Ga0182104_112053223300015297Switchgrass PhyllosphereMIKTSASLVERNRPAFVEIEVAGKSFQRKQIFFPVKSKIDPIFHLPKSAKKLDGEESRTVLLNGNEVIPSNCMPNSREVFVHTCFDEEVRIECSGVDEASVLEDGVSLPFTIISQVELGGIFYINLYDLGLR
Ga0182180_104694013300015306Switchgrass PhyllosphereMTIKTATSLFKGNRLTPVEVEVASKSFPRKQIFLPEKSKINPIFHLPKSAKELDGEEPRTVLNGSEVAPSNCVPNISEVFVHTYFDEEFRIEGSGVDEASVLDDGVGLSFMSVVQVEVGSVIFINFHGLGLHFFVLFLHHGQCWCWFGGMTRA*
Ga0182180_104799413300015306Switchgrass PhyllosphereMNVAAPRCELAMDNLTQNLAPKFMTIKTSASLVERNRPAFVEIQVAGKSFPRKQIFFPEKSKVNLIFHLPKIAKKLDGEESRTILLNGNEVIPSNFVPNIREVFVHTCFDEEVWNECSGVDEASVLENGIALSFMIISQVEVRCIFRINLYDLSLRFGLH
Ga0182182_102273623300015311Switchgrass PhyllosphereMNVIALSCKSAMDNLTRNPPPKFMTIKTAASLLKRNRPAFVEIKVASKSFPRKQIVLPEKSKINPIFHLPKSAKELDGEEPRTILLNGNEVTPSNCMPNISEVFVHTCFDEEFWIEGSGVDEGSVLEDGIDLSFTSVLCTYLF*
Ga0182182_106606713300015311Switchgrass PhyllosphereNIAAPRCKLAMDNLTRNPDPRLMTIKTSASLVQRNRPAFVEIERAGKSFPGKQILFPENSKINPVFHLPKSAKKLDGEESRTILLNGNKVIPANFMPSFREVFIHTCFDEEVRIECSGVDETSVLEDGIALSFTIISQVEVRCIFRINLYDLSLQFGLHLFVLFFFLVVHRALCKLRFGCV*
Ga0182120_102737813300015315Switchgrass PhyllosphereMNIVAPRCKFAMDNLTRNLAPKFMTIKTAASLIERNRPAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEELRTILLNRNEVIPSNCMPNISEVFVHTYFEEEFRIEGSGVDEASVLEDGVALSVTIISQVEVGSIIFINFCGLGLRIGLHFFLLFFFFIVHHAVVGLGSGVCELEPP*
Ga0182120_105838813300015315Switchgrass PhyllosphereMNVIAPRCKSAMDNLTRNLPPKFMTIKTAASLLKRNWPAFVEIEVASKSFPKKQIVLLEKSKINPIFHLPKSAKELDGEEPRTILLNGNEIAPSNCVLNISEVFVHTCFDEEIRIECSGVDVASVLEDGVALAFTIISQVEVRGIFCVYLYGLGLRFGLHLFALFFFL
Ga0182121_109447213300015316Switchgrass PhyllosphereKSFPKKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHSCFDEEVRIECSGVDETSVLEDGVALSFTIISQVEVWCIFHINLYHLGLRFGLHLFVLFFFFVVHRAWCRRRFGCVRA*
Ga0182121_111789613300015316Switchgrass PhyllosphereMIKTAASLIERNRPAFVEIKVAGNSFPRKQIFFPEKSKINPVFHLPKRAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTCFDEDVRIECSGVDEASVLENGVALSFTIISQVEVRCIFRINLYHLGLWFGLHLFILFFFLIVH
Ga0182181_107960813300015318Switchgrass PhyllosphereMNIVAPRCKLAMDNLTQNLAAKFMTIKTTASLLKRNLPAFVEIEVASKRFPRKQIFFLKKSKINPIFHLPKSAKKLDGEESRTILLNGNEVILSNFMPNIREVFVHTYFDEEIQIECSGVDEASVLEDGVALTFTIISQVEVGSIFCINFYDLGLRFGLHL
Ga0182181_110517713300015318Switchgrass PhyllospherePKLMTIKTAASLLKRNWPAFVEIEVAGKSFPRKQIPFPEKSKIDPVFHLPKSAKKLYGEESRTVLLNGNEVIPSNCMPNSREVFVHTCFDEEFRIEGSGVDETSVLEDGVPLSFTIISQVEVGSISFVNFYGHSLQFGLHLFVLLFFFIVHRSWCRCRFGSVRARATSRIR*
Ga0182130_103615813300015319Switchgrass PhyllosphereLLKRNWPAFVELEVVGKSFSRKKILFPEKSKINTVFHLPKCAKKLDGEESRTILLNGNEVIPSNFLLNIREVFVHTCFDEEIWIKCSGVDETSVLEDGIALAFTIISQVEVGGIFCINFYGLGLRFDLHLFVLYFFLIVHRACVGVGSGVYEPKPPCRCLTPSLLRDTLSNKVCR*
Ga0182130_110538313300015319Switchgrass PhyllosphereTAASLIEKNRPAFVEIEVTGKSFPRKQIFFPEKSKINPISHLPKSAKKLDGEESRTILLNGNEVIPSNFKPNVREVFVHTYFHEELRIEGSRVDEASVLEDGVALSFTIILQVEVGNILFINFYGLGLQFGLHLFILFFFLIVHRAWCRRRFGSVQALATPRTG*
Ga0182165_105303123300015320Switchgrass PhyllosphereMNVTAPRCELAMDNLTRNLAPKFMMIKTSASLVERNWPAFLEIEVAGKSFPRKQIFFPKKSKVNPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFIHTYFDEEVRIECSGVDEASVLEDGVALSFTIISQVEVRCIFRINLWLRLAVWLASLRVVLLLRSPSCLV*
Ga0182134_108466113300015324Switchgrass PhyllosphereMDNLTKNQTPKLMTIKTAASLLKGNWLAFVEIEVASKSFPRKQIFHPEKSKINPIFHLPMSAKELDGEEPRTVLLNGNEVAPSNCVPNISEVFVHTYFDLEFQIEGSGVDEASVLDGGVGLSLTSIA*
Ga0182148_107486713300015325Switchgrass PhyllosphereERNRPAFVEIEVAGKSFPRKQIFFPKKSKINPIFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNIREVFVHTCFDEEVWIEGSGVDEASVLEDGVALSFMIFSQVEVRCIFCINLYDPDLQYGCISSYCSSSS*
Ga0182148_113464713300015325Switchgrass PhyllosphereMNIAAPRCELAMDNLTRNLAPKFMTIKTAASLIERNRLVFVEIKVASKSFPRKQILLPEKSKINPVFHLLKSAKKLDDEESRTILLNGNEVIPSNCMPNVREVFVHTYFDEEVWIEGSGVDEASVLEDGVALSFT
Ga0182148_113678313300015325Switchgrass PhyllosphereSFPKKKIFFPEKSKIDPFYHLPKSEKKLDGEESRTVLLNGNEVIPSNFMPNIRDDFVHTCFDEEVRIECSGVDETSVLENGVALSFMIISQVEVWCIFRINLYLGWRFSLHLFILFFFLIVHRAWAWRRFRGVARA*
Ga0182166_112652313300015326Switchgrass PhyllosphereMTIKTAASLVKRNRSAFVEIEMASKSFPRKQVVLPKKAKINPIFHLPKSAKKLDSEEPRTILLNGNEVVPSNCVPNISKVFVHTCFDEEFQIEGSGVDEASVLDDGVALSFMSITQVEVGSVIFINFHGLGL
Ga0182166_114162913300015326Switchgrass PhyllosphereAASLIERNRPAFVEIEVAGKSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNIREVFVHTCFDEEIRIEHSGVDETSILEDGVALSFMIISQVEVGSIFCINFYGLGLRFGLHLFILFFFFIVHRAWCRRRFGSVRA*
Ga0182114_114528313300015327Switchgrass PhyllosphereMTIKTSASLVERNRPAFVEIEVAGKSFSRKQIFFPEKSKINPIFHLPESAKKLDGEESRTILLNRNKVIPSNCMPNIREVFVHTCFDEEFQIECSGVDEASILEDGVALSFTMISQVEVGGIFCVNLYDLGLRFSLHLFVLF
Ga0182153_114092213300015328Switchgrass PhyllosphereMNVIALRCKSAKDNLTRNLLPKFMTIKTAASLLKRNWPAFVEIEVASKSFPRKQIILPEKSKINPIFHLPKSAKKLDGEEPRTVLLNRNEVVPSNCVPNISEVFIRTCFDEEFQIEGSGVDEASVLEDGVALSFTIISQVEVESVIFVNFYGLGLRF
Ga0182135_106778413300015329Switchgrass PhyllosphereMTIEPAVSLLKRNRPVFVEIEVASKNFPRKQIFLPKKSKINPIFHLPKSAKELDGEEPRTVLPNGSEVAPSNCVPNISEVFVHTCFDEEFRIEGSGVDEASVLDDGVALSFTSVVQVEVGSVIFINFYGLGLWFGLHLFVLFFLFVVHHPRAWHR
Ga0182135_109025713300015329Switchgrass PhyllosphereMTIKTAASLFKRNHPAFVEIEVARKSFGRKQIIFPENSKINPIFHLPKSAKELDGEEPRTILLNGNEVTPSNCMPNISEVFVHTCFDEEFRIEGRGMDEASVLEDGVALSFTSIAQVEVGSVIFINFHGLGLRFGLHFFVLFFFFV
Ga0182152_110224313300015330Switchgrass PhyllosphereMNVAAPRYELAMDNLTQNLTPKFMTIKTAASLFKGNWPTLVEIEVASKGFPRKKILLPEKSKVNPIFHLPKSANELDGEESRTILLNGHKVVPSNCLPNISKVFVHTCFGEEFRTESSSVGKALILKDGVALSFMIISQVEVQCVFRINLYDLGLQFGLHLFILFFFFIVH
Ga0182131_104247223300015331Switchgrass PhyllosphereMNITAPRCKLSMDNLTRNLAPKFMTIKTAASFLKRNRPMLVEIEVASKSFPRKQIYLPEKLKVNPIKSAKKLDGEEPQTVLLNGNKVVPSNRMQNVSEVFVHTCFDEEFRIEGSGMDEASVLGDDVALSFMITSQVEVGCIIFINFHGFGLRF
Ga0182131_112761813300015331Switchgrass PhyllosphereMNIAAPRCKLAMDNLTRNPAPKLMMIKSSASLVQRNWPVFVEIEVAGKSFPRKQILFPENSKVNHVFHLPKSAKKLDGEESRTILLNGNKVIPSNFMPNVREVFVHTCFDEEVRIEGSGVDEASVLEDGVALSFTII
Ga0182117_100263513300015332Switchgrass PhyllosphereDPYNLSWKESDGKPFVQQTKGQVLNIVAPRCKLAMNNLTRNLTPKLMMIKTAASLLEKNWPAFVEIEVASKSFPRKQILFPEKSKINPIFHLPKSAKKLDGEESRTILLNGNEVIPFNFMPNVREAFVHTCFDDEIRIESSGVDEASVLEDGVALSFTIILLVEVGASSALISMVVVCGSACISSYCSSSS*
Ga0182117_108885813300015332Switchgrass PhyllosphereMDIVAPRCKLAMDKFSRNLSPKFMTIKTAASFLKRNRPMLVEIEVASKSFPRKKIILPEKSKVNPIFHLPKSAKELDGEEPRTILLNGNEVTPSNCMPNISEVFVHTCFDEEFWIEGSGVDEGSVLEDGIDLPFTSVL
Ga0182147_105526013300015333Switchgrass PhyllosphereEVAGKSFPRKKIFFPEKSKINPVFHLPKSARNLDGEESTIVLLDGNEVIPSNFMPNIRDDFVHTCFDEEVRIECSGVDEASVLEDGVALSFMIIPQVEVGGIFCINLYDLVLQFDLHLFVLFFFLVVHRAWCRHRFGCVRA*
Ga0182147_107368923300015333Switchgrass PhyllosphereMNVVAPRCKLAMDNLTRNLAPKFMTIKTAASLLERNWPALVEIEVANKSFPRKQVFFPEKSKINPVFHFPKSAKKLDGEESRTILLNGNEVIPSNFMPNIREVFVHTYFDEEIRIECSGVDEASVLEDGVALSFTIISQVEVRCIFRINLYDLGLRFGLHLFILFFFFIVHRAWCRRRFRCVRA*
Ga0182132_116193613300015334Switchgrass PhyllosphereMNVAAPRCELAIDNLTQNLAPKFMTIKTAASLIERNWPVFVEIKVAGKSFPRKQIFFPKKSKINPIFHLPKSAKKLDGEESRTILLNENEVIPSNYMPNVREVFVHTYFDEEIQIECSGVDEASVLEDGIALAFTIISQVEVGGILYINLYGIGLQF
Ga0182137_112435713300015338Switchgrass PhyllosphereNRPAFVEIEVASKSFPRKQIILPEKSKINPIFHLPKSAKKLDGEESRTILLNGNEIIPSNFMPNVREVFVHTCFDEEFRIECSGMDKGPVVEDGIALSFTIISQVEVRCIFRINLYDLGLRFGVHLFILFFFLVVHRAWCRRRFGSVRA*
Ga0182133_107397013300015340Switchgrass PhyllosphereMNVIAPRCKSAMDNLTQNLPPKFMTIKTTASLLKRNRPAFVEIEVASKSFPRKQIVLPKKSKVNPIFHLPKSAKELDGEELRTVLLNGSEVAPSNCVPNISEVFVHTCFDEEFRIEGSSVDEASVLDDGVGLSFMSVA*
Ga0182133_111975813300015340Switchgrass PhyllosphereMNIVAPRCKLAMDNMNQNLAPKFMTIKTAASLLKRNWLVFVEIEVAGKTFPRKQILFPEKSKTNPVFQLPKSAKKLDGEESRTILLNGNEVVPSNFMPNIREVFVHTCFDEEVQIEGSGVDEASVLEDGVALSFTIISQVEVRCIFRINLYDLGLWFGLHSSYCSSSS*
Ga0182115_119679913300015348Switchgrass PhyllosphereMNITAPRCELAMDNLNQNPAPKLMTIETSASLIERNRPAFVEIKVAGKSFPRKQIFFPEKSKVNPIFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTCFDEEVRIEYSGVDEASVLEDGVALSFTIISQVKVRYIFRVNLYDLGLRFGLHLFILFFFFVVHRAWCRRRFGCVRA*
Ga0182115_128004613300015348Switchgrass PhyllosphereGSDIISWEESDGQPLVHQLKSWIMNITAPRCKLAMDNLTRNPAPKLMMIKTSASLVQRNRPAFVEIEVAGKSFPRKKILFPEKSKINPVFHLPKSAKKLDGEESRTILLSGNEVIPSNCMPNVREVFVHTCFDEEVRIKCSGVDEASVLEDGVALSFMIISQVEVRCIFRINLYDL
Ga0182115_128556813300015348Switchgrass PhyllosphereLTRNLAPKFMTIKTVASLLKRNWPVFVEIEVAGESFPRKQILFPEKSKINPFFHLSTSAKKLDGEESRTILLNGNEVIPFNFMPNVREAFVHTCFDDEIRIESSGVDEASVLEDGVALSFTIILLVEVGASSALISMVVVCGSACISSYCSSSS*
Ga0182185_115673913300015349Switchgrass PhyllosphereMNVVALRCKLAMDNLTRNLAPKFMTIKTTASLLERNWPVLVEIEVADKSFSRKQVFFPEKSKINPVFHFPKSAKKLDGEESRTILLNGNEVIPSNCMPNVREVFVHTCFDEEIRIECSGVEEASVLEDGVALSFMIISQVEVGGIFCINLYGLGLRFG
Ga0182185_124250213300015349Switchgrass PhyllosphereNPAPKFITIKTAARLVERNQLAFVEIEVAGKNFPRKQIFFPKKSKINPVFHLSKSAKKLDGEESRTILLNGNKVIPSNCIPNVREVFVHTCFDEDVRIECSGVDEASVLEDGVALSFTIISQVEVYCIFHINLYDLGLRFGLHLFILFFLFIVHRAWCRRRFGCVRA*
Ga0182163_108238923300015350Switchgrass PhyllosphereMNVIAPWCKSAMDNLTRNLSPKLMTIKTVASLLKGNWLAFVEIEVASKSFPRKQIFLPEKSKINPIFHLPKSAKELDGEEPRTILLNGNEIAPSNCVPNISEVFVHTSFDEEFQIEGSGVDEASVFDHGVGLMFTSVAQVEVGSIILINFHVLGLWLGLHVFVLFFLFVVHHGWCWCRFGGIMRARLTP*
Ga0182169_122343723300015352Switchgrass PhyllosphereMTIKTSASLVKRNWSAFVEIEVAGKSFPRNQIFFPKKLKVNPVLHLSKSAKKLDGEESRTILLSGNVIIPSNFMPYVRQVFVHAYFDEEVWIECSSVDEASVLEDGVALSFTIISQVEVRCIFCVNLYG
Ga0182169_123093013300015352Switchgrass PhyllosphereMTIKPAVSLLKRNRPVFVEIEVASKNFPRKQIFLPEKSKINPIFHLPKSAKKLDGEEPRTVLLNGGEVAPSNCVPNIREVFLHTCFNEQFRIEGSGVDEASVLDDGIGLSFTSV
Ga0182169_125727913300015352Switchgrass PhyllosphereMNTAAPRCKLAMDNMNQNLAPKFMTIKTAASLLKRNWLVFVEIEVAGKTFPRKQILFPEKSKTNPVFQLPKSAKKLDGEESRTILLNGNEIIPSICMPNVREVFVHTYFDEEIQIECSGVDEASVLEDGIALAFTIISQVEVGGIFCINFYGFGLRFGLHLFIL
Ga0182179_122829323300015353Switchgrass PhyllosphereMNIAAPRCELAMDNLTRNPAPKFMTIKTAASLVERNRPAFVEIELASKSFPRKQIFFPKKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSSCMPNISEVFVHTYFDEEIRIECSGVDEASVLEDGIALVFTIISQVQVGASSMSISM
Ga0182167_125719313300015354Switchgrass PhyllosphereVFVEIEVAGKSFPRKQILFPEKSKIDPIFHLPKSAKKLDGEESRTVLLNGNEVIPSNCMPNISEVFVHTYFDEEFRIEGSGVDEASVLEDGIALSFTIISQVEVGSIIFVNFYGFDLRFGLHLFVLFFFFIVHRAWCRHRIGSVR
Ga0182197_102418413300017408Switchgrass PhyllosphereMDNLIRNLAPKLMTIKTAASLLKRNWPAFVEIKVASKSFPSKQIFLPEKSKINPIFHLPKSVKKLDGEEPRTVLLNGSKFAPSNCLPNISEVFVHTSFDEEFRIEGSGVDEASVFDDGVSLALTSLAQVEVGSVI
Ga0182199_118561313300017412Switchgrass PhyllosphereKRNQPVFVEIEVASKSFPRKQIILPEKSKINPIFHLPKSAKKLDGEESRIILLNRNEIIPPNCMPNVREVFVHTCLDEEIRIECSGVDEASVLEDGVALSFTIISQVEVQEIVCVNPYDLGLRFGLHLLVLFFFLVVHRAWCRRRFGSVRA
Ga0182195_108547523300017414Switchgrass PhyllosphereIKTAASLLKRNWPAFVEIEVAGKSFPRKQVFFPEKSKINPIFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNVIEVFVHTCFDEEIRIKCLGVDEASVLENGIALSFMIISQAEVRCIFRINLYDLGLWFGLRLFVLFFFLVVHRAWHRRRFGCVQARATPRMG
Ga0182213_124849013300017421Switchgrass PhyllosphereDNLTRNLALKLMTIKTAASLLKRNWPAFVELEVAGKSFSRKKILFPEKSKINLVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNVREVFVHTYFDEEFWIDCSGVDEASILENGVALSFTIISQVEVGSVIFINFHGLGLWFGLHLFVLFFHFVVHHAPAWRRFGS
Ga0182201_109274113300017422Switchgrass PhyllosphereMNVIAPRCKSAMDNLTRNLPPKLMTIKTVASLLKRNRLAFIKIEVASKSFPRKQIFFPEKSKINLVFHLPKRAKKLDGEESRTILLNGNEVIPSNFMPNVRKVFVLTCFDEEVRIECSGVDEASVLEDGVALSFTIISQVEVRCIFHINLYDLGLRFGLHLFILFFFFI
Ga0182194_106934913300017435Switchgrass PhyllosphereSLIKRNWPMFVEIEVAGKSFPRKQIFFLEKFEINPIFHLPKSAKKLDGEEPRTVLLNGNEVVPSNCMPDISEVFEHTYFDEEFRIEGSGVDKASVLDNGVGLSLTSVAQVEVGSVILINFHVLGLWLGLHVFVLFFLFVVHHGWCWCRFGGIMRARLTP
Ga0182194_108852213300017435Switchgrass PhyllosphereMNVTAPRCELAMDNLTRNLAPKFMKIKPAASLIERNRPVFVEIEVAGKSFPRKQILFLEKSKINPVFHLPKSAKKLDGEESKTILLNGNEVIPSYFMPNIREVFVHTCFDEEVRIECSGVDEASVLEDGVALSFTIISQVKVW
Ga0182200_105949813300017439Switchgrass PhyllosphereMNVIAPKCKSAMDNLTQNLPPKFMTIKTAASLLKRNWPMFVEIEVASKSFTRKQIILPKKSKINPIFHLPKSAKKLDGEELRTVLLNGNEVVPSNCVPNISEVFVHTCFDEEFRIEGSGVDETSVVEDGVALLFTIVSQVEVGSIIFINFHGLGLPFSLHFFVLFFFFIVNHAWGQSRFKSV
Ga0182200_110228723300017439Switchgrass PhyllosphereVERNWPTFVEIEVAGKSFPRKQIFFPEKSKGNPVFHLPMSAKKLDGEESRTILLNGNEVIPSNFVPNISDVFIHTCFDEEVRIECSGVDEASVLEDGVALSFMIISQVKVWCIFRINLYDLGLQ
Ga0182214_108546023300017440Switchgrass PhyllosphereMNVIAPRCKFAMDNLTRNLSPKFKTIKTAASLLKRNRPAFVEIKVASKSFPRKQIVLPEKSKINPIFHLPKSAKELDCEEPRTVLLNGSEVAPSNCVPNIREVFLHTCFNEQFRIEGSGVDEASVLDDGISLSFTSVVQVEVGSVIFIHF
Ga0182215_115658513300017447Switchgrass PhyllosphereMNIITPRCKLALDNLSRNLAPKFMTIKTAASLLQRNWPAFVEIEVTSKSSPRKKIPFPEKSKINPVFHLLKSVKKLDNEESRTILLNGNEVIPSNCMPNVREVFVHTCFDEEVQIEGSSVDEASVLEDGIALSFTIISQVEVR
Ga0182212_116927413300017691Switchgrass PhyllosphereAMDNLTRNLPPKFMTIKTAVSLLKRNRPAFVEIEVACKSFPRKQIVLPEKSKINPIFHLPKSAKELDGEEPRTVLLNGSEVAPSNCVPNISEVFIHTYFDEEFRIEGSGVDEASVLDDGVGLSFMSVVQVEVGSVIFINFHGLGLHFFVLFLHHGQCWCWFGGMTR
Ga0182216_120637323300017693Switchgrass PhyllosphereFVHQTKSWILYVVAPRCKLAMDNLTLNLTPKFTTIKTTASLFKGNWPTLVEIEVASKSFPRKKLLLQEKSKVNPIFHLPKSAKELDGEESRTIILNGHKVVPLNCMPNISKVYIHTYFGEEFRIESSSVGKASILRMA
Ga0182211_108703713300017694Switchgrass PhyllosphereMNIIAPRCKLAMDKLTRNLAPKVMTIKTAASLLKRNWPVFVEIEVAGESFPRKQILFPEKSKINPFFHLSTSAKKLDGEESRTILLNGNEVIPSNFVPNIREVFIHTGFDEEVRIECSGVDEASVLEDGIALSFMIISQVEVGCVIFINFHGLGLRFGLHSIVLFLFFLIIHRAWAWRRFRGVARA
Ga0207703_1163151313300026035Switchgrass RhizosphereSDGQPLVHQLKSWIMNIAAPRCKLAMDNLTRNLAPKFMTIKTAASLIERNRPAFVEIEVAGKSFPRKQIFFPEKSKVNPVFHLPESAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTCFDEEVRIECSGVDEAFVLEDGVALSFTIISQIEVWCIFRINLYDLGLRFGLHLFVLFFLFVVHHAWGRRRFGCVRA
Ga0268322_105183213300028049PhyllosphereCASNEELDCVCRCSGCKLAKDNLTRNLTPKLMTVKTAASLFKRNNPALVEIEVASKSFPRNQIFFLKKSKVNLIFHLLKSAKKLDGEESRTVLLDGNEVVPTNCMPNISKVFGHTYFYEEFRIEGSGVDEASVLEDGVALSFTSVMQVEVGSVIFVNFHGLGLPHGLG
Ga0268330_103068513300028056PhyllosphereMNVAARRCKLAMDNLTRNLAPKFMAIKTAASSIERNWPAFIEIEVAGKSFPRKQILFPEKSKVNPVFHLPKSAKKLDGEESGTVLVNGNEVIPSNCMPNVREVFVHTCFDEEVRIECWGVDETSVLEDGVALSFTIIPQVEVRGIFSFNLYDLGLR
Ga0268330_105370613300028056PhyllosphereMDNLTRNPAPKFMMIKTSASLVERNRPAFVEIEVAGKSFPRKEIFFPEKSKVNPVFHLPKIAKKLDGEESRTILLNGNEVIPSNFVPNVREVFVHTYFDEEVRIECSGVDEASVLEDGVALSFMIISQVEVRCIFHINLYDLGLRFRLHLFILFFF
Ga0268314_102946613300028061PhyllosphereMDNLTRNPAPKFMMIKTSASLVERNRPAFVEIEVAGKSFPRKEIFFPEKSKVNPVFHLPKIAKKLDGEESRTILLNGNEVIPSNFVPNVREVFVHTYFDEEVRIECSGVDEASVLEDGVALSFMIISQVEVR
Ga0268334_101139723300028140PhyllosphereMNVITPGCKFAMDNLTQNLSPKFMTIKTAASLLKRNRPAFVEIEVASKSFPRKQIFLPEKSKINPIFHLPKSAKKLDGEESRTILLNGNEVIPSNGMPNVREVFVHTCFDEEVRIEGSGVDEASILEDGVALSFTIISQVVVRCIFRINL
Ga0268304_100042633300028256PhyllosphereMDNLTRNPAPKLMTIKTSASLVQRNRPAFVEIEVAGKSFPKKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNIREVFVHTYFDEEVRIEGSGVDEASVFEDGVALSFTIISQ
Ga0268310_103763013300028262PhyllosphereKLSMDNLTRNLAPKLMTIKTVASLLKRNWPTFVEVEVAGKYFPRKQILFPKKSKINPVFHLPKSAKKLDGEETRTILLIRNEVIPSNFMPNVREVFVHTCFDEEFQIEGSGVDEALVLEDGVALAFMIISQVEVGSISFVNFYGLSLRFGLHLFVLFFFFIVHRAWCRRRFGCVRA
Ga0268265_1073014823300028380Switchgrass RhizosphereLVHQLKSWIMNIAAPRCKLAMDNLTRNPAPKLMTIKTSASLVERNWPAFVEIEVAGKSFPRKQIFFPEKSKVNPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNIREVFVHTCFDEEVRIECSGVDKASGTERLVPGLVLRKLGKFLWR
Ga0268315_101379613300028472PhyllosphereMNVIAPRCKSAMDNLTRNPPPKFMTIKTAASLLKRNRPAFVEIEVASKSFPRKQIILPEKSKINPIFDLPKSAKKLDGEELRTVLLNGNEVVPSNCVLNISKVFVHTCFDEEFRIEGSGVDEALVLDDGVALLFTSVAHVEVGSIIFISFHGLGLRFGLHLFILFFLFVLLIVHCGRCWCRFRGM
Ga0268319_100768013300028473PhyllosphereKLAMDNLTQNLPPKLMTIKTTACLLKRNWPAFFEVEVAGKSFPRKQILFPEKSKINPVFHLLKSVKKLDNEESRTILLNGNEVIPSNCMPNVREVFVHTCFDEEVRIEGSGVDEASVLADGIALSFTIISQVEVRCIFRINLYDLGLRFGLHLFILFFFLVVHHAWCRHRFGCVRA
Ga0268331_101467913300028474PhyllosphereMNVIALSCKSAMDNLTRNPPPKFMTIKTAASLLKRNRPAFVEIEVASKSFPRKQIILPEKSKINPIFDLPKSAKKLDGEELRTVLLNGNEVVPSNCVLNISKVFVHTCFDEEFRIEGSGVDEALVLDDGVALLFTSVAHVEVGSIIFISFHGLGLRFGLHLFILFFLFVLL
Ga0268311_101339323300028529PhyllosphereLAMDKLTQNPAPKLMTIKTSASLVERNWPAFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNCMPNIREVFVHTCFDEEVRIECSGVDEASVLEDGVALSFMIISQVEVRCIFHINLYDLGLRFRLHLFILFFFLIVHRAWCRRRFGCVRA
Ga0214490_111147013300032502Switchgrass PhyllosphereLVHQAKGWIMNVIAPGCKFAMDNLTQNLSPKFMTIKTAASLLKRNRPAFVEVEEASKSFPRKQIFLPEKSKINPIFHLPKSAKKLDGEEPRTVLLNESKVAPSDCMPNISEVFVHTYFNEEFRIKGSGVDEASVLDDDVGLSLTSVAQVEVGSVIFINFHGLGLWLGLHLSYCSSCSSCS
Ga0214490_114601713300032502Switchgrass PhyllosphereMNIAAPRCELVMDNLNRNPAPKLMTIKTSASLVQRNRPVFVEIEVAGKSFPRKQILFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVILSNFMPNIREVFVHTCFDEEVRIEGSGVDEASVLEDSVALSFMIISQVEVRGIFSINLYDLGLQFGL
Ga0321340_105806623300032550Switchgrass PhyllospherePKFITIKTAASLIERNRPAFVEIKVAGNSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEVIPSNFMPNVREVFVHTYFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA
Ga0214501_127589013300032625Switchgrass PhyllosphereDNLTRNLAPKFMTIKTAASLIERNWPVFVEIEVAGKSFPRKQIFFPEKSKVNPVFHLSESAKKLDGEDSRTILLNGNEVIPSNCMPNVREVFVHTYFDEEVWIECSGVDVASVLDDGVALSFMSITQVEVGSVIFINFHGLGLRFGLRSVMFFLFFPIVHRAWAWRRFGGVARA
Ga0214497_108251923300032689Switchgrass PhyllosphereASLIERNRPVFVEIKVAGNSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEIIPSNCMPNIREVFVHICFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA
Ga0314733_106913213300032761Switchgrass PhyllosphereIMNIATPRCKLAMDNLTQNLAPKFMMIKTAANLLKRNWPAFVEIEVAGKSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEIIPSKVFVHICFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA
Ga0314735_102782823300032824Switchgrass PhyllosphereMNVAAPRCELAMDNLTRNLAPKFITIKTAASLIERNRPVFVEIKVAGNSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEIIPSKVFVHICFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA
Ga0314760_107622613300033530Switchgrass PhyllosphereRNLSQKLMTIKTAASLLKRNWPAVVEIKVARKSFPRKQIFFPEKSKIDLIFHLPKSAKKLDGEESRTILLNGNEIIPSKVFVHICFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA
Ga0314757_108673423300033534Switchgrass PhyllosphereAASLIERNRPVFVEIKVAGNSFPRKQIFFPEKSKINPVFHLPKSAKKLDGEESRTILLNGNEIIPSNCMPNIREVFVHICFDEEVRIECSGVDEALVLEDGVALSLTIISQVEVRCIIRINFYDLGLRFGLHLFVLFFFLIVHRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.