NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093489

Metagenome / Metatranscriptome Family F093489

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093489
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 45 residues
Representative Sequence MANVVIDIAAEFTGNKAFKQAETSTEKLTKNVKKLAGAIGLGF
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 94.74 %
% of genes near scaffold ends (potentially truncated) 89.62 %
% of genes from short scaffolds (< 2000 bps) 80.19 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (81.132 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(31.132 % of family members)
Environment Ontology (ENVO) Unclassified
(63.208 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(49.057 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF05065Phage_capsid 2.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 2.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.74 %
UnclassifiedrootN/A12.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10148622All Organisms → Viruses → Predicted Viral2154Open in IMG/M
3300002408|B570J29032_109563911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300003394|JGI25907J50239_1062637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300003491|JGI25924J51412_1009298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1861Open in IMG/M
3300003986|Ga0063233_10080086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300004282|Ga0066599_100864064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300005581|Ga0049081_10326178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300005662|Ga0078894_10693413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage899Open in IMG/M
3300006030|Ga0075470_10187760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300006805|Ga0075464_10307040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300006920|Ga0070748_1320546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300007363|Ga0075458_10270881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300007639|Ga0102865_1086610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300007972|Ga0105745_1027984All Organisms → Viruses → Predicted Viral1457Open in IMG/M
3300007973|Ga0105746_1004519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3812Open in IMG/M
3300008110|Ga0114343_1029045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2331Open in IMG/M
3300008111|Ga0114344_1014549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3646Open in IMG/M
3300008111|Ga0114344_1142570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage827Open in IMG/M
3300008262|Ga0114337_1165175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage942Open in IMG/M
3300009157|Ga0105092_10587867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300009158|Ga0114977_10438384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300009165|Ga0105102_10208155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300010160|Ga0114967_10292030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300010970|Ga0137575_10070084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300011010|Ga0139557_1077162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300012708|Ga0157595_1072168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300012723|Ga0157604_1195954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300013006|Ga0164294_10513867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300013006|Ga0164294_11214416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300013372|Ga0177922_10489277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300015243|Ga0180041_102004All Organisms → Viruses → Predicted Viral4044Open in IMG/M
3300016697|Ga0180057_1010764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300017722|Ga0181347_1027230All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300017736|Ga0181365_1039391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1189Open in IMG/M
3300017736|Ga0181365_1081739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300017761|Ga0181356_1163223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300017774|Ga0181358_1277734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300017777|Ga0181357_1239735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300017778|Ga0181349_1080308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1242Open in IMG/M
3300017784|Ga0181348_1175947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300017785|Ga0181355_1159742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage905Open in IMG/M
3300019784|Ga0181359_1266695Not Available511Open in IMG/M
3300020539|Ga0207941_1019474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1013Open in IMG/M
3300020555|Ga0208358_1014491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1430Open in IMG/M
3300021438|Ga0213920_1038943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1035Open in IMG/M
3300021519|Ga0194048_10039840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1936Open in IMG/M
3300021961|Ga0222714_10247361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1002Open in IMG/M
3300022190|Ga0181354_1111830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300022407|Ga0181351_1027163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2431Open in IMG/M
3300022407|Ga0181351_1280723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300024346|Ga0244775_10786535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300025635|Ga0208147_1062612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300027659|Ga0208975_1212293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300027710|Ga0209599_10059766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1002Open in IMG/M
3300027721|Ga0209492_1020142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2289Open in IMG/M
3300027733|Ga0209297_1306287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300027785|Ga0209246_10187318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300027797|Ga0209107_10301311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300027805|Ga0209229_10418404Not Available580Open in IMG/M
3300027808|Ga0209354_10187364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300027900|Ga0209253_10275716All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300027963|Ga0209400_1311115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300027972|Ga0209079_10187174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
(restricted) 3300028569|Ga0247843_1144585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
(restricted) 3300028571|Ga0247844_1114531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300031857|Ga0315909_10122912All Organisms → Viruses → Predicted Viral2190Open in IMG/M
3300031951|Ga0315904_11002175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300031951|Ga0315904_11042259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300031951|Ga0315904_11375752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300031963|Ga0315901_10637789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300032050|Ga0315906_10438167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300032093|Ga0315902_10791575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300032116|Ga0315903_10649485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300032116|Ga0315903_10936128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300032116|Ga0315903_11080397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300033993|Ga0334994_0207108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1056Open in IMG/M
3300033994|Ga0334996_0066259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2192Open in IMG/M
3300034020|Ga0335002_0399551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300034050|Ga0335023_0563814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300034062|Ga0334995_0555325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300034066|Ga0335019_0096795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1981Open in IMG/M
3300034092|Ga0335010_0339781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage845Open in IMG/M
3300034092|Ga0335010_0602299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034101|Ga0335027_0700507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300034102|Ga0335029_0442123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300034106|Ga0335036_0559818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300034112|Ga0335066_0153025All Organisms → Viruses → Predicted Viral1406Open in IMG/M
3300034118|Ga0335053_0831875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300034120|Ga0335056_0067830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2272Open in IMG/M
3300034120|Ga0335056_0443711All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300034120|Ga0335056_0506841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300034122|Ga0335060_0585117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300034168|Ga0335061_0237194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300034283|Ga0335007_0645048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300034284|Ga0335013_0653929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater31.13%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake20.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.43%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.89%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.94%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.94%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.94%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.94%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.94%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.94%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.94%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003491Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003986Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015243Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020555Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1014862213300000882Freshwater And MarineVANIVIDLAAQFTGANAFKKADTATDKLTKNVKSLGKT
B570J29032_10956391123300002408FreshwaterMANVVIEVATEFTGKKAFKEADTATQKLTRNVKKLA
JGI25907J50239_106263713300003394Freshwater LakeMSNVAINIAAEFTGKKAFKEADTATQKLTKNVKKLAGAVGI
JGI25924J51412_100929813300003491Freshwater LakeMAADVRIDIAAEFVGAKAFKKADQATAKLSRSVKGLAATLGVAF
Ga0063233_1008008623300003986Freshwater LakeMAADVRIDIAAEFVGAKAFKKADQATAKLSRSVKGLAATLGV
Ga0065166_1023200423300004112Freshwater LakeVSNVAINIAAEFLGKRAFKQADTATAKLTKSVKTLAGAFGL
Ga0066599_10086406423300004282FreshwaterMANVMIDIAAEFTGNKAFKQAESSTDKLGKNVKKLAGALGLAFGGQ
Ga0049081_1032617813300005581Freshwater LenticMANIVIDIAAEFTGKNAFKQAETSTDKLTKNLKNMAKTLGVGFSAA
Ga0078894_1069341313300005662Freshwater LakeMANVMIDIAAEFTGNKAFKQADSATNKLTKNVKQLAGAFGLAFGTT
Ga0075470_1018776023300006030AqueousMAADVKIDIAAEFTGKKAFRQAETATDKMTKNVKKLAGALGLAFGG
Ga0075464_1030704013300006805AqueousMAADVKIDIAAEFTGKKAFRQAETSTQKLTSGVKKLAGAIGLAYVT
Ga0070748_132054613300006920AqueousMTILIDLAAEFTGKKAFKQAETATDKLTKSAKSLAKAFGIAFGAKQIARF
Ga0075458_1027088123300007363AqueousMSNIVIDIAAEFTGKKAFKQAETSTDKLGKQAKKLAGALGLAF
Ga0102865_108661013300007639EstuarineMAADVKIDIAAEFTGKKAFKQADTATQKLTGNVKKLA
Ga0105745_102798443300007972Estuary WaterMAADVKIDIAAEFTGKKAFKQADTATQKLTGNVKKLAGAVGLAYGTSAIIAY
Ga0105746_100451983300007973Estuary WaterMAADVKIDIAAEFTGKKAFKQADTATQKLTCNVKKLAGA
Ga0114343_102904563300008110Freshwater, PlanktonMAQPSVLISLAAEFVGKKAFKQADSATEKMTKNVK
Ga0114344_101454993300008111Freshwater, PlanktonMANVFIDILAEFTGKKAFKQADSATEKLTKNVQTLAKTFGVAFSATAVLAYSKNAI
Ga0114344_114257013300008111Freshwater, PlanktonMAADVRIDIAAQFVGKKAFKEAETSTDRLTKNVKGLAKGL
Ga0114337_116517513300008262Freshwater, PlanktonMADVKIDIATEFTGKKAFKQAETATDKLNRGVKNLASTFGLAFGTAAVL
Ga0105098_1002640313300009081Freshwater SedimentMAVTNLMIGIGAEYKGRGAFKQAETATQKLTKSVRNLAGAFGIAFGTRA
Ga0105092_1058786723300009157Freshwater SedimentMANVLIDIAAEFTGNKAFKQAETSTEKLTRNVKKLAGAV
Ga0114977_1043838413300009158Freshwater LakeMANVVIDIAAEFTGNKAFKQADTATQKLTSNVKKLAGAVG
Ga0105102_1020815513300009165Freshwater SedimentMANVLIDIAAEFTGNKAFKQAETSTEKLTRNIKKLAGAVGIAFSATAIVNFGK
Ga0114967_1029203023300010160Freshwater LakeMANVVIDIAAEFTGNKAFKQADTATQKLTSNVKKLAGAVGLAY
Ga0137575_1007008423300010970Pond Fresh WaterMANVLIEIASEFTGNKAFKQADSATDKLTKNVKSLA
Ga0139557_107716213300011010FreshwaterVANVFIDIAAEFVGNKAFKQADSATDKLTKNVKSLGKSLGLAL
Ga0157595_107216813300012708FreshwaterMAADVKIDIAAEFTGKKAFRQADTATEKMSKNVKKLAGA
Ga0157604_119595423300012723FreshwaterMASVFIDIAAEFTGKKAFKQAETSTEKLTKNVKQLAKTFGLAFGTAQVIAYGK
Ga0164294_1051386713300013006FreshwaterMANIVIVIAAEFTGKNAFKQAEFSTDKLTKGLKNV
Ga0164294_1121441613300013006FreshwaterMANVVIDIAAEFTGNKAFKQADTATQKLTSNVKKLA
Ga0157622_115159623300013310FreshwaterMSNVAINIAAEFTGKKAFKQAETSTDKLTKSVKRLAAGVVLAFGTKQIV
Ga0177922_1048927723300013372FreshwaterMANVVIDIAAEFTGNKAFKQADTATQKLTSNVKKLAGAVGLAYG
Ga0180041_10200413300015243FreshwaterMAADVRIDIAAEFTGKKAFKQAETSTDKLTKNVKGLAKGLLA
Ga0180057_101076433300016697FreshwaterMAADVKIDIAAEFTGKKAFRQADTATEKMSKNVKKLAGALGLAFGGQ
Ga0181347_102723053300017722Freshwater LakeMAADVKIDIAAEFTGAKAFKKAETATDKMSKNVKKLAGTLGLAFGGQQLLAFA
Ga0181365_103939143300017736Freshwater LakeMANIVIDIASEFTGAKAFKQADSATDKLTKNVKKLAATVGLAYSTTRVL
Ga0181365_108173913300017736Freshwater LakeMANIVIDIAAEFTGKNAFKQAETSTDKLTKNIKNMAKTLG
Ga0181356_116322313300017761Freshwater LakeMANVMIDIAAEFVGNKAFKQADTATQKLTKNVKQLAGAFGVAFGTTAV
Ga0181358_127773413300017774Freshwater LakeMAIDPSVRIDIAAEFTGKNAFNKADKSTDKLTKNVKKLAAAFGLAF
Ga0181358_128958113300017774Freshwater LakeMANVVIDIASEFTGAKAFKQADFATSKLTKSVKNLAATFGVTFSARALVNYSK
Ga0181357_123973523300017777Freshwater LakeMAADVKIDIAAEFTGAKAFKKAETATDKMSKNVKKLAGTLGL
Ga0181349_108030843300017778Freshwater LakeMANIVIDIASEFTGAKAFKQADSATDKLTKNVKKLAATVGLAYSTTRVLAYAKS
Ga0181348_117594713300017784Freshwater LakeMANIVIDIASEFTGAKAFKQADSATDKLTKNVKKLAATVG
Ga0181355_115974213300017785Freshwater LakeMANIVIDIASEFTGAKAFKQADSATDKLTKNVKKLAATGGLAYSTTRVLAYAKSSVN
Ga0181359_126669523300019784Freshwater LakeMAADVKIDIAAEFTGKKAFKQADTATQKLTSNVKKLAGAVGL
Ga0207941_101947413300020539FreshwaterMAVDPSVRIDIAAEFTGKKAFKQADTATAKLMKSVKSLAGGLG
Ga0208358_101449143300020555FreshwaterMANVMIDIAAEFVGNKAFKQADSATDKLTKNVKKLAGAF
Ga0213920_103894323300021438FreshwaterMAADVRIDIAAQFVGKPAFRQAENATFSLTKSVKKLAGALGIAYGTQAVV
Ga0194048_1003984013300021519Anoxic Zone FreshwaterMSNIVIDIAAEFTGNKAFKQAESETDKLIKNVKKLAKT
Ga0222714_1024736113300021961Estuarine WaterMANVFIDIAAEFTGNKAFKQADSATEKLNKGVKQLAKTFGLAFGTAQVV
Ga0181354_111183033300022190Freshwater LakeMATDPALRIDIASVFTGKKAFKQADTATEKLMKNTKKL
Ga0181351_102716373300022407Freshwater LakeMANVVIDIAAEFTGNKAFKQADTATQKLTSNVKKLAGAVGLAYGTSAII
Ga0181351_110650213300022407Freshwater LakeMAADVKIDIAAEFTGAKAFKKAETATDKMSKNVKKLAGTLGLAFGGQQLLAFAKAS
Ga0181351_128072323300022407Freshwater LakeMANIVIDIAAEFTGKNAFKQAENSTDKLTKNLKSVAKTLGVAFSVQQVLAFS
Ga0244775_1078653533300024346EstuarineMANVMIDIAAEFTGNKAFKQADSSTDKLTKNVKKLAGA
Ga0208147_106261213300025635AqueousMANVIIDIAAEFTGNKAFKQAETSTDKLVKNVKKLAGATGL
Ga0208644_116867923300025889AqueousMSNVAINIAAEFTGKKAFKQAETSTDKLVKSTKRLAGALGLAFGTAQIIAF
Ga0208975_121229313300027659Freshwater LenticMANIIIDIAAEFTGKNAFKQAETSTDKLTKNIKSLAKTLGVAFSVQQVLAF
Ga0209599_1005976613300027710Deep SubsurfaceMAIATIDIAAEFTGKKAFKQAETATDKLSKGVKNLAGAFGLAFGTTAVLN
Ga0209492_102014273300027721Freshwater SedimentMANVVIDIAAEFTGNKAFKQAETSTEKLTKNVKKLAGAIGLGF
Ga0209297_130628713300027733Freshwater LakeMAADVKIDIAAEFTGKKAFKQADTATQKLTSNVKKLAG
Ga0209500_1030277513300027782Freshwater LakeMANIVIDIASEFTGAKAFKQADSATSKLTKRVKTL
Ga0209246_1018731813300027785Freshwater LakeMSNIVIDIAAEFTGNKAFKQAESATDKLGKQAKKLAAAFGLGLSATAVLAYGKA
Ga0209107_1030131133300027797Freshwater And SedimentMANIVIDIAAEFTGKNAFKQAETSTDKLTKNIKSMAKTL
Ga0209229_1041840413300027805Freshwater And SedimentMAADVKIDIAAEFTGKRAFKQAESATSNLTKSVKKLAGAFGIAYGTQAVIA
Ga0209354_1018736413300027808Freshwater LakeMAIDPSVRIDIAAEFTGKNAFNKADKSTDKLTKNVKKLAAAFGLAFS
Ga0209253_1027571613300027900Freshwater Lake SedimentMSNIVIDIAAEFTGKKGFNQADKATDKLGKSVKKLAGAFGLAL
Ga0209400_131111513300027963Freshwater LakeMSNIVIDLAAEFTGKKAFKQAQNSTTSLTKAVNVLAKRF
Ga0209079_1018717413300027972Freshwater SedimentMANVLIDIAAEFTGNKAFKQAETSTEKLTRNVKKLAGAVGLAFSAT
(restricted) Ga0247843_114458513300028569FreshwaterMAADVKIDIAAEFTGKKAFKQAETSTDKLIKSVKKLGGVFGLAFGTQQVIA
(restricted) Ga0247844_111453133300028571FreshwaterMAADVKIDIAAEFTGKKAFKQAETSTDKLIKSVKKLGGVFGLAFGTQQVIAFGKR
Ga0315909_1012291213300031857FreshwaterMASVFIDIAAEFTGKKAFKQAETSTEKLTKNVKQLAKTFGLAFGTAQVI
Ga0315904_1100217513300031951FreshwaterMANVFIDILAEFTGKKAFKQADSATEKLTKNVQTLAKTFGVAFSA
Ga0315904_1104225923300031951FreshwaterMANVMIDIAAEFVGNKAFKQADNATDKLTKNVKKLAGAFGLAFSATAVL
Ga0315904_1137575223300031951FreshwaterMSNIVIDIAAEFTGNKAFKQAESATDKLGKQAKKLAAAFGLGLSATA
Ga0315901_1063778913300031963FreshwaterMANVFIDIAAEFTGNKAFKQADSATEKLNKGVKQLAKT
Ga0315906_1043816733300032050FreshwaterMAQPSVLISLAAEFVGKKAFKQADSATEKMTKNVKKLAGALGLAFSAT
Ga0315902_1079157533300032093FreshwaterMANVMIDIAAEFVGNKAFKQADTATDKLTKNVKTLAKTFGLAFSSA
Ga0315903_1064948513300032116FreshwaterMANVVIDIATEFTGKKAFKEADTATQKLTKSVKRFAGAAGIAFGTTAVL
Ga0315903_1093612813300032116FreshwaterMANVMIDIAAEFVGNKAFKQADSATDKLTKNVKKLAGAFGLAFGTTQILAFG
Ga0315903_1108039723300032116FreshwaterMANVFIDILAEFTGKKAFKQADSATEKLTKNVQTLAKTFGVAF
Ga0334994_0207108_2_1573300033993FreshwaterMANVMIDIAAEFVGNKAFKQADTATDKLTKNVKKLAGAFGLAFSTTAVLAYG
Ga0334994_0343529_1_1653300033993FreshwaterMANVFIDILAEFTGKKAFKQAEASTDKLGKSVKKLAGSLGVAFGTQQIVSYGKRA
Ga0334996_0066259_2073_21923300033994FreshwaterMSNIVIDIAAEFTGKGAFKKAETSTDKLTKGVKSLAKTLG
Ga0335002_0399551_3_1073300034020FreshwaterMANVMIDIAAEFTGNKAFKQADSSTDKLTKNVKKL
Ga0335023_0563814_428_5803300034050FreshwaterMSNIVIDIAAEFTGKKGFKQAETATDKMSKNVKKLAGALGLAFSGQQILAF
Ga0334995_0555325_547_6753300034062FreshwaterMSNIVIDIAAEFTGKNAFKKAETSTDKLSKGVKSLAKTLGVAF
Ga0335019_0096795_2_1393300034066FreshwaterMAVDPSVRIDIAAEFTGKKAFKQADTATAKLTKSVKSLAGGLGIAF
Ga0335010_0339781_691_8433300034092FreshwaterMAADVKIDIAAEFTGKKAFKQAETSTEKLTKNVKQLAASIGLAYSGTRVLA
Ga0335010_0602299_439_5553300034092FreshwaterMANVVIEVATEFTGKKAFKEADTATQKLTRNVKKLAGAV
Ga0335022_0479079_3_1493300034095FreshwaterMSNVAINIAAEFTGKKAFKQAETSTDKLNKSVKKLAGGLLLAFGTKQIL
Ga0335027_0700507_3_1553300034101FreshwaterMANVVIDIAAEFTGNKAFKQADSATTTLTKNVKKLAGAVGLAYSTQAIVNF
Ga0335029_0442123_630_7703300034102FreshwaterMANVVIDIAAEFTGNKAFKQADSATTTLTKNVKKLAGAIGLAYSTQA
Ga0335036_0559818_569_7003300034106FreshwaterMAADVKIDIAAEFTGKKAFKQADSSVEKLNAKTKNLGKTLTRTF
Ga0335066_0153025_1254_14063300034112FreshwaterMANVVIDIAAEFTGNKAFKQAESSTDKLIRSTKKLAGAIGIAFSAQAIVNF
Ga0335053_0831875_357_5063300034118FreshwaterMANVMIDIAAEFVGNKAFKQADTATDKLTKNVKKLAGAFGLAFSTTAVLA
Ga0335056_0067830_1_1443300034120FreshwaterMANVMIDIAAEFVGNKAFKQADSATDKLTKNVRKLAGAFGLAFSTTAV
Ga0335056_0443711_586_6903300034120FreshwaterMANVVIDIAAEFTGNKAFKQADSATTTLTKNVKKL
Ga0335056_0506841_1_1233300034120FreshwaterMANVIIDIAAEFVGKPAFKQAETSTERLTKSVKKLAGAVGI
Ga0335060_0585117_402_5633300034122FreshwaterMANVMIDIAAEFTGNKAFKQAESATDKLGKQAKKLAAAFGLGLSATAVLAYGKA
Ga0335061_0237194_3_1073300034168FreshwaterMANIIIDIAAEFTGNKAFKSAETSTDKLTKNIKNM
Ga0335007_0570375_493_6603300034283FreshwaterMANVMIDIAAEFTGNKAFKQADSSTDKLTKNVKKLAGAFGLAFSATAVLAYGKAAV
Ga0335007_0645048_1_1563300034283FreshwaterMSNIVIDIAAQFTGKGAFKQAETSTDKLTKNIKNMAKTLGVAFSATAVLNYA
Ga0335013_0653929_484_6063300034284FreshwaterMANIIIDIAAEFTGNKAFKSAETSTDKLTKNIKNMAKTLGV
Ga0335048_0297062_3_1163300034356FreshwaterMANVVIDIAAEYTGNKAFKQAETATQKLEKSVGKLGKQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.