NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093686

Metagenome Family F093686

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093686
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 46 residues
Representative Sequence GMLSISLPDEKIDCALQQRQERNQEKEQPASKTAESKFQR
Number of Associated Samples 94
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.75 %
% of genes near scaffold ends (potentially truncated) 51.89 %
% of genes from short scaffolds (< 2000 bps) 81.13 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.736 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.698 % of family members)
Environment Ontology (ENVO) Unclassified
(37.736 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.566 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.18%    β-sheet: 0.00%    Coil/Unstructured: 58.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF14827dCache_3 18.87
PF00672HAMP 2.83
PF02687FtsX 0.94
PF00501AMP-binding 0.94
PF00211Guanylate_cyc 0.94
PF00141peroxidase 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.94
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.74 %
UnclassifiedrootN/A12.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02GLEZ3All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
2170459011|GKWS7RC01DP46AAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium509Open in IMG/M
2209111022|2221199100All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300002911|JGI25390J43892_10116115All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium608Open in IMG/M
3300005175|Ga0066673_10320238All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae905Open in IMG/M
3300005187|Ga0066675_10338444All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1097Open in IMG/M
3300005187|Ga0066675_10528720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae883Open in IMG/M
3300005294|Ga0065705_10032768All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1346Open in IMG/M
3300005294|Ga0065705_10731539All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia634Open in IMG/M
3300005295|Ga0065707_10045100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia930Open in IMG/M
3300005295|Ga0065707_10649275All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia659Open in IMG/M
3300005327|Ga0070658_11205212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia658Open in IMG/M
3300005337|Ga0070682_100620187All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia857Open in IMG/M
3300005337|Ga0070682_100689421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia818Open in IMG/M
3300005445|Ga0070708_100051434All Organisms → cellular organisms → Bacteria3650Open in IMG/M
3300005454|Ga0066687_10087172All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1547Open in IMG/M
3300005540|Ga0066697_10027124All Organisms → cellular organisms → Bacteria → Proteobacteria3152Open in IMG/M
3300005546|Ga0070696_100373405All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1110Open in IMG/M
3300005577|Ga0068857_100172159All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1968Open in IMG/M
3300006028|Ga0070717_10453747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1155Open in IMG/M
3300006028|Ga0070717_10600342All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia998Open in IMG/M
3300006032|Ga0066696_10186320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1316Open in IMG/M
3300006755|Ga0079222_10006271All Organisms → cellular organisms → Bacteria → Proteobacteria4020Open in IMG/M
3300006796|Ga0066665_10418736All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1106Open in IMG/M
3300006804|Ga0079221_10206706All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1080Open in IMG/M
3300006914|Ga0075436_101240965All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium563Open in IMG/M
3300007788|Ga0099795_10113384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.1077Open in IMG/M
3300009029|Ga0066793_10661783All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia594Open in IMG/M
3300009137|Ga0066709_101884289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia833Open in IMG/M
3300010303|Ga0134082_10098203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1157Open in IMG/M
3300010304|Ga0134088_10216986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia917Open in IMG/M
3300010321|Ga0134067_10117541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia924Open in IMG/M
3300010322|Ga0134084_10154210All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia775Open in IMG/M
3300010359|Ga0126376_12629248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300011119|Ga0105246_11434604All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia645Open in IMG/M
3300012198|Ga0137364_10255658All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1295Open in IMG/M
3300012204|Ga0137374_10234189All Organisms → cellular organisms → Bacteria → Proteobacteria1553Open in IMG/M
3300012208|Ga0137376_11417341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300012208|Ga0137376_11793775All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium504Open in IMG/M
3300012209|Ga0137379_10476578All Organisms → cellular organisms → Bacteria → Proteobacteria1156Open in IMG/M
3300012211|Ga0137377_10440352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1241Open in IMG/M
3300012285|Ga0137370_10735224All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia613Open in IMG/M
3300012285|Ga0137370_10780030All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300012285|Ga0137370_10918372All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300012582|Ga0137358_10109331All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1875Open in IMG/M
3300012918|Ga0137396_10263490All Organisms → cellular organisms → Bacteria → Proteobacteria1272Open in IMG/M
3300012922|Ga0137394_11281045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium596Open in IMG/M
3300012927|Ga0137416_10476195All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1071Open in IMG/M
3300012944|Ga0137410_10126028All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1927Open in IMG/M
3300012958|Ga0164299_10275435All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1020Open in IMG/M
3300015245|Ga0137409_10029371All Organisms → cellular organisms → Bacteria5349Open in IMG/M
3300015356|Ga0134073_10186270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia680Open in IMG/M
3300015359|Ga0134085_10192304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia877Open in IMG/M
3300015371|Ga0132258_13930393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1010Open in IMG/M
3300015372|Ga0132256_101441977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia800Open in IMG/M
3300018054|Ga0184621_10244317All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia641Open in IMG/M
3300019361|Ga0173482_10036516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1521Open in IMG/M
3300019873|Ga0193700_1026746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia952Open in IMG/M
3300019876|Ga0193703_1009788All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1434Open in IMG/M
3300019879|Ga0193723_1009727All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3108Open in IMG/M
3300019879|Ga0193723_1112059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia763Open in IMG/M
3300019880|Ga0193712_1024766All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300019886|Ga0193727_1089966All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus919Open in IMG/M
3300020002|Ga0193730_1123417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia708Open in IMG/M
3300020012|Ga0193732_1039567All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia811Open in IMG/M
3300020062|Ga0193724_1013503All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1735Open in IMG/M
3300020170|Ga0179594_10054389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1359Open in IMG/M
3300021344|Ga0193719_10292564All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia684Open in IMG/M
3300021411|Ga0193709_1016103All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1837Open in IMG/M
3300022534|Ga0224452_1265413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300023058|Ga0193714_1035742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia727Open in IMG/M
3300024288|Ga0179589_10133086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1047Open in IMG/M
3300025915|Ga0207693_10161953All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1760Open in IMG/M
3300025916|Ga0207663_10671244All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium819Open in IMG/M
3300025922|Ga0207646_10027122All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5223Open in IMG/M
3300025931|Ga0207644_10514700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia988Open in IMG/M
3300025945|Ga0207679_10207422All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1641Open in IMG/M
3300026116|Ga0207674_10330960All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300026327|Ga0209266_1157037All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium909Open in IMG/M
3300026331|Ga0209267_1223875All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia696Open in IMG/M
3300026508|Ga0257161_1029479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1073Open in IMG/M
3300026528|Ga0209378_1030156All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2868Open in IMG/M
3300027775|Ga0209177_10465960All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300028791|Ga0307290_10205587All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia722Open in IMG/M
3300028799|Ga0307284_10491435All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium504Open in IMG/M
3300028807|Ga0307305_10259595All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus793Open in IMG/M
3300028814|Ga0307302_10456888All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia633Open in IMG/M
3300031231|Ga0170824_120303154All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia734Open in IMG/M
3300031469|Ga0170819_14635155All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300031740|Ga0307468_101976203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium558Open in IMG/M
3300031820|Ga0307473_10927827All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia631Open in IMG/M
3300032074|Ga0308173_11409389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia654Open in IMG/M
3300033412|Ga0310810_10715584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia927Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere3.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459011Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cmEnvironmentalOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_122838502170459005Grass SoilLLSIRLPDEEVDCALQQRQERNQEKEQTASKTAESKFQR
F62_008438102170459010Grass SoilNPGAGAETGFDLGEGMVPIGLADDKIGRALQQRQEGNQEKEQPATETAESKVQR
F64_055436102170459011Grass SoilVCSISFRKIAGTAAEAGLNLRHCMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR
22220235122209111022Grass SoilLNLRQGMLSISLPDEKVACALQQRQERNQEKEQPASKTAESKFQR
JGI25390J43892_1011611523300002911Grasslands SoilENAGTGAEAGLNLRQSMLSISLPDEKVDCALQQRQEHNQEKEQPASKTAESKFQR*
Ga0066683_1050974323300005172SoilENSGAGAETGFDLGEGVVPISLADDKIGRALQQRQERNQEKEQPATETAESKFQR*
Ga0066673_1032023823300005175SoilLNLRHGMLSISLPDEKVRCALQQRQERNQEKEQPASKTAESKFQR*
Ga0066675_1033844413300005187SoilLGEGMVAIALADDKIGCALQQRQEGNQEKEEPATETAKSKFQR*
Ga0066675_1052872023300005187SoilMLSISLPDEKVDCALQQRQERKQEKEQPASKTAEPKFQR*
Ga0065705_1003276833300005294Switchgrass RhizosphereNAGTAAEAGLNLRQGMLSISLPDEKVDCALQQRQERNQEKEQSASKTAESKFQR*
Ga0065705_1073153913300005294Switchgrass RhizosphereAEAGLNLRQGMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR*
Ga0065707_1004510033300005295Switchgrass RhizosphereLGEGMVPIGLADDKIGRALQQRQEGNQEKEQPATETAKSKFQR*
Ga0065707_1064927513300005295Switchgrass RhizosphereTAAEAGLNLRQGMLSISLPDEKVDCALQQRQERNQEKEQSASKTAESKFQR*
Ga0070658_1120521213300005327Corn RhizosphereMLSISLPDEKVDCALQQRQERNQEKEQPASETAESEFQR*
Ga0070682_10062018713300005337Corn RhizosphereTGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR*
Ga0070682_10068942113300005337Corn RhizosphereLRHGMLSISLPDEKVDCALQQRQKRNQEKEQPASETAESEFQR*
Ga0070708_10005143413300005445Corn, Switchgrass And Miscanthus RhizosphereLNLRHGMLSIGLPDEKVDCALQQGQERNQEKEQPASKTAESKFQR*
Ga0066681_1046752723300005451SoilGAGAETGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR*
Ga0066687_1008717233300005454SoilGAEAGLNLRQSMLSISLPDEKVDCALQQRQEHNQEKEQPASKTAESKFQR*
Ga0066687_1059235613300005454SoilLIENSGAGAETGFDLGEGMVAIALADDKIGCALQQRQEGNQEKEEPATETAKSKFQR*
Ga0066697_1002712443300005540SoilMLSISLPDEKVDCALQQRQERKQEKEQPASKTAESKFQR*
Ga0070696_10037340533300005546Corn, Switchgrass And Miscanthus RhizosphereTGFDLGEGMMPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR*
Ga0068857_10017215923300005577Corn RhizosphereMLSISLPDEKVDCALQQRQKRNQEKEQPASETAESEFQR*
Ga0070717_1045374733300006028Corn, Switchgrass And Miscanthus RhizosphereAGAETGFDLGEGMVPIGLADDKIGRALQQRQKRNQEKEEPATETAESKFQR*
Ga0070717_1060034233300006028Corn, Switchgrass And Miscanthus RhizosphereLGEGMVPIGLADDKIGRALQQRQERNQEKEEPATETAESKFQR*
Ga0066696_1018632033300006032SoilLNLRDGMVSISFPDEQVDCALQQCQERNEEKQQPASETAESKFQR*
Ga0079222_1000627123300006755Agricultural SoilMAPIGLADDKIGRALQQSQEGNQEKEQPAAETAESKFQR*
Ga0066665_1041873633300006796SoilGMLSISLPDEKVDCALQQRQERKQEKEQPASKTAESKFQR*
Ga0079221_1020670633300006804Agricultural SoilENSGAGAETGFDLGKGMAPIGLADDKIGRALQQSQEGNQEKEQPAAETAESKFQR*
Ga0075436_10124096523300006914Populus RhizosphereLGEGMLPIGLADDKIGCALQQRQEGNQEKEQPAAETAESKFQR*
Ga0099795_1011338423300007788Vadose Zone SoilMLAISLPDEKVDCALQQRQEREQEKEQPASKTAESKFQR*
Ga0066793_1066178323300009029Prmafrost SoilMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR*
Ga0066709_10188428933300009137Grasslands SoilSLPDEKIDCALQQCQERNQEKQQPASKTAESKFQR*
Ga0134082_1009820323300010303Grasslands SoilMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR*
Ga0134088_1021698613300010304Grasslands SoilGAEAGLNLREGMLSISLPDEKIDCALQQCQERNQEKQQPASKTAESKFQR*
Ga0134067_1011754133300010321Grasslands SoilGFDLGEGMVPIGLADDQIGRALQQRQERNQEKEEPATETAESEFQR*
Ga0134084_1015421023300010322Grasslands SoilAGLNLRDGMVSISLPDKKVNCALQQCQERNEEKQQPASEAAESKFQR*
Ga0126376_1262924813300010359Tropical Forest SoilMLSISLADDEVDGALQQRQERKQEKKQSASKTAKSKFQR*
Ga0126379_1125030813300010366Tropical Forest SoilLIENSGAGAETGLNLGESMVPIRLADDKIGRALEQCQECNQEKEQPATETAESKFQR*
Ga0105246_1143460413300011119Miscanthus RhizosphereSISLPDEKVDCALQQRQERNQEKEQPASETAESEFQR*
Ga0137364_1025565833300012198Vadose Zone SoilMLSISLPDEKIDCALQQRQERNQEKEQPASKTAEAKFQR*
Ga0137374_1023418923300012204Vadose Zone SoilMLSISLPDEKIDCALQQRQERNQEKEQPASKTAESKFQR*
Ga0137376_1141734113300012208Vadose Zone SoilNAGTGAEAGLNLRQSMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR*
Ga0137376_1179377513300012208Vadose Zone SoilENAGTGAEAGLNLRQSMLSISLPDEKVACALQQCQERNQEKEQPASKTAESKFQR*
Ga0137379_1047657823300012209Vadose Zone SoilMLSISLADEEVDCALQQRQERKQEKEQPASKTAESKFQR*
Ga0137377_1044035213300012211Vadose Zone SoilISLPDEKIDCALQQRQERNQEKEQPASKTAEAKFQR*
Ga0137370_1073522413300012285Vadose Zone SoilLRKRVLAVSLSDYKVGRALEQRQESNQEKEQAAPKTAESKFQ*
Ga0137370_1078003013300012285Vadose Zone SoilQFFENAGTGAEAGLNLRQSMLSISLPDEKVDCALQQRQEHNQEKEQPASKTAESKFQR*
Ga0137370_1091837223300012285Vadose Zone SoilFENAGTGAEAGLNLRQSMLSISLPDEKVDCALQQRQERDQEKEQPASKTAESKFQR*
Ga0137358_1010933143300012582Vadose Zone SoilREGMLSISLPDEEIDCALQQCQERNQEKQQPASKTAESKFQR*
Ga0157282_1009969113300012904SoilNSGAGAETGFDLGEGMAPIGLPDDKIGRALQQRQERNQEKEEPAAETAESKFQR*
Ga0137396_1026349023300012918Vadose Zone SoilMLSISLPDEKVDSALQQRQERNQEKEQPASKTAEPKFQR*
Ga0137394_1128104523300012922Vadose Zone SoilPYVTAVQAGTAAETGLNLRHGMLSISLPDEKVDSALQQRQERNQEKEQPASKTAESKFQR
Ga0137416_1047619523300012927Vadose Zone SoilMLAISLPDEKVDCALQQRQERNQEKEQPASKTAEPKFQR*
Ga0137410_1012602823300012944Vadose Zone SoilMLSISLPDEKVDCALQQRQERNQEKEQPTSKTAESKFQR*
Ga0164299_1027543513300012958SoilNSGAGAETGFDLGEGMVPLGLADDKIGGALQQCQERNQEKEQPATETAESKCQR*
Ga0164301_1138394323300012960SoilFDQLIENSGPGAETGFDLGEGMVPIGLADDKIGRALQQRQKGNQEKEQPATETAESKFQR
Ga0164306_1053453933300012988SoilSGAGAETGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEEPATETAESKFQR*
Ga0163162_1271654923300013306Switchgrass RhizosphereQLIENSGAGAKTGFDLGEGMVPIGLADDKIGGAWRQRQERNQEKEQPATETAESKFQR*
Ga0137409_1002937153300015245Vadose Zone SoilMLSISLPDEKVDCALQQRQEREQEKEQPASKTAESKFQR*
Ga0134073_1018627023300015356Grasslands SoilMVPIGLADDKIGRALQQRQERNQEEEQPATETAESKFQR*
Ga0134085_1019230413300015359Grasslands SoilAEAGFNLRHGMLSIGLPDEKVDCALQQRQERKQEKEQPASKTAESKFQR*
Ga0132258_1393039333300015371Arabidopsis RhizosphereMMPIGLADDKIRSALQQRQERNQEKEQAAAETAESKFQR*
Ga0132256_10144197723300015372Arabidopsis RhizosphereFDLSKGMVPVGLADDKIGCALQQGKEGNQEKEQPATETAESKFQR*
Ga0184621_1024431713300018054Groundwater SedimentGMLSISLPDEKIDCALQQRQERNQEKEQPASKTAESKFQR
Ga0173482_1003651613300019361SoilLIENSGAGAETGFDLGKGMAPIGLADDKIGRALQQSQEGNQEKEQPATETAESKFQR
Ga0193700_102674613300019873SoilLNLCQGMLSISLPDEKIDCALQQRQECNQEKQQPASKTAESKFQR
Ga0193703_100978833300019876SoilDLRHGMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR
Ga0193723_100972723300019879SoilMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR
Ga0193723_111205913300019879SoilMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0193712_102476623300019880SoilMLSISLPDEKVDCALQQREERNQEKEQPASKTAESKFQR
Ga0193727_108996623300019886SoilMLSISLPDENVDCALQQRQERNQEKKQPASKTAESKFQR
Ga0193730_112341723300020002SoilAGTASEAGFNLRHGMLSISLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR
Ga0193732_103956713300020012SoilTGFDLGEGMVPIGLADDKIGRALQQGQERNQEKEQPATETAESKFQR
Ga0193734_105427423300020015SoilENSGAGAETGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0193724_101350313300020062SoilLIENSGTGAETGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0179594_1005438923300020170Vadose Zone SoilMLSISLPDEKIDCALQQRQERKQEKEQPASKTAEAKFQR
Ga0193719_1029256423300021344SoilEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0193709_101610323300021411SoilLNLRHGMLSISLADEKVDCALQQRQERKQEKEQPASKTAESKFQR
Ga0224452_126541313300022534Groundwater SedimentIGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0193714_103574213300023058SoilNAGTGAEAGLNLRQGMLSISLPDEKIDCALQQRQECNQEKQQPASKTAESKFQR
Ga0179589_1013308613300024288Vadose Zone SoilMLSISLPDEKVDGTLQQRQECKQEKEQPASKTAESKFQR
Ga0207693_1016195313300025915Corn, Switchgrass And Miscanthus RhizosphereSGAGAETGFDLGEGMVPIGLADDKIGRALQQRQKRNQEKEQPATETAESKFQR
Ga0207693_1109942113300025915Corn, Switchgrass And Miscanthus RhizospherePGAGAETGFDLGEGMVAIGLTDDQIGRALQQRQEGNQEKEQPATETAESKFQR
Ga0207693_1114095013300025915Corn, Switchgrass And Miscanthus RhizosphereSGAGAETGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0207663_1067124423300025916Corn, Switchgrass And Miscanthus RhizosphereLNLRHGMLSISLADEKVDCALQQRQERKQENEQPASKTAESKFQR
Ga0207646_1002712253300025922Corn, Switchgrass And Miscanthus RhizosphereMLSIGLPDEKVDCALQQGQERNQEKEQPASKTAESKFQR
Ga0207644_1051470033300025931Switchgrass RhizospherePIGLADDKIGRALQQRQEGNQEKEQPATETAESKVQR
Ga0207679_1020742223300025945Corn RhizosphereMLSISLPDEKVDCALQQRQERNQEKEQPASETAESEFQR
Ga0207674_1033096023300026116Corn RhizosphereMLSISLPDEKVDCALQQRQKRNQEKEQPASETAESEFQR
Ga0209266_115703723300026327SoilMLSISLPDEKVDCALQQRQERKQEKEQPASKTAEPKFQR
Ga0209267_122387513300026331SoilNAGTGAEAGLNLGEGMLSISLPDEKIDCALQQCQERNQEKQQPASKTAESKFQR
Ga0257161_102947933300026508SoilAAEAGFNLRHGMLSISLPDEKVDCALQQRQERKQEKEQPASKTAESKFQR
Ga0209378_103015633300026528SoilMLSISLPDEKVDCALQQRQERKQEKEQPASKTAESKFQR
Ga0209177_1046596023300027775Agricultural SoilMAPIGLADDKIGRALQQSQEGNQEKEQPAAETAESKFQR
Ga0307290_1020558713300028791SoilLNLRQGMLSIRLPDEKVDCALQQRQERNQEKEQPASKTAESKFQR
Ga0307284_1049143513300028799SoilGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESEFQR
Ga0307305_1025959523300028807SoilMLSISLPDEKIDCALQQRQERNQEKEQPASKTAEAKFQR
Ga0307302_1045688823300028814SoilMLSISLPDEKVDCALQQRQERNQEKEQSASKTAESKFQR
Ga0170824_12030315423300031231Forest SoilGFDLGEGMVPIGLADDKIGRALQQRQEGNQEKEQPATETAESKVQR
Ga0170819_1463515523300031469Forest SoilMLSIRLPDEKVNCALQQRQERNQEKEQTASKTAESKFQR
Ga0307468_10197620313300031740Hardwood Forest SoilDQLFENAGTAAEAGLNLRHGMLSISLADEKVDCALQQRQERKQEKEQPASKTAESKFQR
Ga0307473_1092782713300031820Hardwood Forest SoilVAIGLTDDKIGGALQQRQERNQEKEQAATETAESKFQR
Ga0308173_1140938923300032074SoilGTSAEAGFDLRHGMLSISLPDQKVDRALQQRQERNQEKEQPASKTAESKFQR
Ga0307472_10097755723300032205Hardwood Forest SoilSGAGAKAGFDLGEGMVPIGLADDKIGRALQQRQERNQEKEQPATETAESKFQR
Ga0310810_1071558423300033412SoilMLSISLPDKKVGGALQKRQERNQEKKQPASKTAESKFQR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.