NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093787

Metagenome Family F093787

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093787
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 41 residues
Representative Sequence RFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN
Number of Associated Samples 72
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 60.38 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (73.585 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(27.359 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03354TerL_ATPase 51.89
PF03237Terminase_6N 11.32
PF04586Peptidase_S78 10.38
PF04860Phage_portal 10.38
PF05065Phage_capsid 4.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 51.89
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 10.38
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 4.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.85 %
UnclassifiedrootN/A14.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002402|B570J29627_1009750Not Available775Open in IMG/M
3300002835|B570J40625_100208526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.2104Open in IMG/M
3300002835|B570J40625_101014633Not Available708Open in IMG/M
3300005527|Ga0068876_10444153Not Available718Open in IMG/M
3300005528|Ga0068872_10048520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2669Open in IMG/M
3300005581|Ga0049081_10155453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes835Open in IMG/M
3300005581|Ga0049081_10235035Not Available647Open in IMG/M
3300006637|Ga0075461_10213550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.574Open in IMG/M
3300006802|Ga0070749_10114728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1585Open in IMG/M
3300006802|Ga0070749_10121165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1536Open in IMG/M
3300006802|Ga0070749_10145911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1378Open in IMG/M
3300006802|Ga0070749_10212749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1104Open in IMG/M
3300006802|Ga0070749_10464976Not Available692Open in IMG/M
3300006875|Ga0075473_10001895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8635Open in IMG/M
3300007234|Ga0075460_10043703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1700Open in IMG/M
3300007538|Ga0099851_1169654Not Available806Open in IMG/M
3300007541|Ga0099848_1090536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1183Open in IMG/M
3300007541|Ga0099848_1264262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.598Open in IMG/M
3300007559|Ga0102828_1004701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2626Open in IMG/M
3300008111|Ga0114344_1000780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16680Open in IMG/M
3300008263|Ga0114349_1001246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15252Open in IMG/M
3300008266|Ga0114363_1017769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3183Open in IMG/M
3300008339|Ga0114878_1062832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1535Open in IMG/M
3300008450|Ga0114880_1062337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1537Open in IMG/M
3300008450|Ga0114880_1203541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes661Open in IMG/M
3300008450|Ga0114880_1211408Not Available640Open in IMG/M
3300008450|Ga0114880_1243332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes567Open in IMG/M
3300010354|Ga0129333_10242545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1627Open in IMG/M
3300010368|Ga0129324_10043828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2071Open in IMG/M
3300012012|Ga0153799_1003340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4169Open in IMG/M
3300017701|Ga0181364_1012793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1407Open in IMG/M
3300017707|Ga0181363_1001889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4884Open in IMG/M
3300017716|Ga0181350_1035443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1363Open in IMG/M
3300017716|Ga0181350_1094737Not Available741Open in IMG/M
3300017723|Ga0181362_1091124All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.610Open in IMG/M
3300017747|Ga0181352_1004327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4914Open in IMG/M
3300017747|Ga0181352_1153359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.609Open in IMG/M
3300017761|Ga0181356_1032649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1861Open in IMG/M
3300017774|Ga0181358_1014525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3203Open in IMG/M
3300017774|Ga0181358_1066897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1332Open in IMG/M
3300017777|Ga0181357_1013272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3285Open in IMG/M
3300017778|Ga0181349_1083089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1216Open in IMG/M
3300017778|Ga0181349_1089047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1167Open in IMG/M
3300017780|Ga0181346_1176725Not Available784Open in IMG/M
3300017785|Ga0181355_1329627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes566Open in IMG/M
3300017785|Ga0181355_1354470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.539Open in IMG/M
3300019784|Ga0181359_1039069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1838Open in IMG/M
3300019784|Ga0181359_1080388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1222Open in IMG/M
3300020172|Ga0211729_10407650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes671Open in IMG/M
3300020172|Ga0211729_10407801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes671Open in IMG/M
3300020488|Ga0208051_101982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2459Open in IMG/M
3300020550|Ga0208600_1039736Not Available721Open in IMG/M
3300021961|Ga0222714_10046365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3057Open in IMG/M
3300021961|Ga0222714_10424270Not Available697Open in IMG/M
3300021962|Ga0222713_10004812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13389Open in IMG/M
3300021963|Ga0222712_10021726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5309Open in IMG/M
3300021963|Ga0222712_10046914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3258Open in IMG/M
3300021963|Ga0222712_10592266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes641Open in IMG/M
3300022179|Ga0181353_1000229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11091Open in IMG/M
3300022179|Ga0181353_1039697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1245Open in IMG/M
3300022190|Ga0181354_1083116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1055Open in IMG/M
3300022198|Ga0196905_1148805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.603Open in IMG/M
3300022407|Ga0181351_1016358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3100Open in IMG/M
3300022752|Ga0214917_10007968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10538Open in IMG/M
3300022752|Ga0214917_10023793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4884Open in IMG/M
3300023179|Ga0214923_10012431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8396Open in IMG/M
3300024346|Ga0244775_10011700All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8305Open in IMG/M
3300024490|Ga0255185_1033934Not Available716Open in IMG/M
3300024506|Ga0255168_1039609Not Available779Open in IMG/M
3300025635|Ga0208147_1035233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1312Open in IMG/M
3300025635|Ga0208147_1103511Not Available689Open in IMG/M
3300025646|Ga0208161_1015058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3056Open in IMG/M
3300025646|Ga0208161_1104179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes776Open in IMG/M
3300025647|Ga0208160_1080936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes870Open in IMG/M
3300025655|Ga0208795_1153058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.574Open in IMG/M
3300025671|Ga0208898_1126897Not Available726Open in IMG/M
3300025889|Ga0208644_1129060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1193Open in IMG/M
3300025889|Ga0208644_1137559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1140Open in IMG/M
3300027793|Ga0209972_10237240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes828Open in IMG/M
3300027804|Ga0209358_10011930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5707Open in IMG/M
3300027806|Ga0209985_10016052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4875Open in IMG/M
3300027816|Ga0209990_10003145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12273Open in IMG/M
3300027816|Ga0209990_10166821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1035Open in IMG/M
(restricted) 3300029286|Ga0247841_10018649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8165Open in IMG/M
3300031669|Ga0307375_10714521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes576Open in IMG/M
3300031758|Ga0315907_10100680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2477Open in IMG/M
3300031758|Ga0315907_10198568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1681Open in IMG/M
3300031857|Ga0315909_10010149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10082Open in IMG/M
3300031857|Ga0315909_10033584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4936Open in IMG/M
3300031857|Ga0315909_10087941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2719Open in IMG/M
3300031857|Ga0315909_10097452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2545Open in IMG/M
3300031857|Ga0315909_10208660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1539Open in IMG/M
3300031951|Ga0315904_10007008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15229Open in IMG/M
3300031963|Ga0315901_10299676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1332Open in IMG/M
3300032093|Ga0315902_10427991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1183Open in IMG/M
3300032116|Ga0315903_10006296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15210Open in IMG/M
3300032116|Ga0315903_10166528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2002Open in IMG/M
3300033978|Ga0334977_0056995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2159Open in IMG/M
3300034064|Ga0335001_0054985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2303Open in IMG/M
3300034072|Ga0310127_082386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1446Open in IMG/M
3300034073|Ga0310130_0013433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2770Open in IMG/M
3300034073|Ga0310130_0021592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300034073|Ga0310130_0034531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1547Open in IMG/M
3300034092|Ga0335010_0586426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes568Open in IMG/M
3300034095|Ga0335022_0317369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes875Open in IMG/M
3300034106|Ga0335036_0004461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11930Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake27.36%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous19.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater11.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.49%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.77%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water3.77%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.83%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.89%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.94%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002402Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020488Freshwater microbial communities from Lake Mendota, WI - 17OCT2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024490Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024506Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J29627_100975013300002402FreshwaterVSTPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN*
B570J40625_10020852613300002835FreshwaterPPAFRFKNSPIGGNQSKSVQNGHTSVRIDADSPFISPDQSGAN*
B570J40625_10101463313300002835FreshwaterPPAFRFKNSPIGGNQSKSVQNGHTTIRIDADSPFISPDQSGAN*
Ga0068876_1044415313300005527Freshwater LakeRFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN*
Ga0068872_1004852033300005528Freshwater LakeRFNNSPKGANQSKSVQNGHTSIHVDADSPFISPGQPGAN*
Ga0049081_1015545323300005581Freshwater LenticRFKISPIGPNQSKSVQNGHTSIHVDADSPFISPGQPGAN*
Ga0049081_1023503523300005581Freshwater LenticRFNNSPKHTNRSESVQNGHTTIHVDADSPFISPGQPGAN*
Ga0075461_1021355023300006637AqueousPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN*
Ga0070749_1011472823300006802AqueousRFKNSPIGGNQSKSVQNGHTTVRIDPDSPFISPERSGAN*
Ga0070749_1012116523300006802AqueousSDKKSPIGPNQSKSVQNGHTTIKIDTDSPFINPERSGAN*
Ga0070749_1014591123300006802AqueousPDKNSPKGANQSKSVQNGHTSIRIDPESPFISSDQSGAN*
Ga0070749_1021274923300006802AqueousRFKNSPIGGNQSKSVQNGHTTIRIDADSPFISPDQSGAN*
Ga0070749_1046497613300006802AqueousNNSPIGGNRSKSVQNGHTLIHVDADSPFINPDQSGAN*
Ga0075473_10001895123300006875AqueousRFKNSPKGANQSKIVQNGHTTVRIDPDSPFMLPDQSGAN*
Ga0075460_1004370333300007234AqueousRFNNSPIGGNRSKSVQNGHTTIHVDADSPFISPGQPGAN*
Ga0099851_116965413300007538AqueousFNNSPIGGNRSKSVQNGHTTIHVDADSPFINPGQPGAN*
Ga0099848_109053613300007541AqueousRFNNSPKHTNRSESVQNGHTTIHVDADSPFINPSQLGAN*
Ga0099848_126426223300007541AqueousFNNSPIGGNRSKSVQNGHTTIHVDADSPFISPGQPGAN*
Ga0102828_100470133300007559EstuarineRFKISPKGANQSKSIQNGHTSIHVDADSPFINPGQPGAN*
Ga0114344_1000780283300008111Freshwater, PlanktonRFKISPIGPNQSKPVQNGHTSIHVDADSPFISPGQSGAN*
Ga0114349_1001246243300008263Freshwater, PlanktonRFNNSPKGANQSKSVQNGHTTVHIDADSPFISPGQSGAN*
Ga0114363_101776913300008266Freshwater, PlanktonPFKISPKSDNQFKSVQNGHTTVRIDQDSPFNTPDQLGAN*
Ga0114878_106283223300008339Freshwater LakeRFKISPKGANQSKSVQNGLTTIRVDANSPFINPGQPGAN*
Ga0114880_106233723300008450Freshwater LakeRFNNSPKGANQSKSVQNGHTTIHVDANSPFINPGQPGAN*
Ga0114880_120354113300008450Freshwater LakeRFNNSPKGANQSKSVQNGHTIVHVDADSPFISPGQPGAN*
Ga0114880_121140823300008450Freshwater LakeFRFNNSPKGANQSKSVQNGHTTIHVDADSPFINPGQPGAN*
Ga0114880_124333213300008450Freshwater LakeQTRFKNSPIGGNQSKSVQNGHTTIRIDADSPFISPDQSGAN*
Ga0129333_1024254513300010354Freshwater To Marine Saline GradientRFKNSPIGGNQSKSVQNGHTTIKIDTDSPFISPDQSGAN*
Ga0129324_1004382833300010368Freshwater To Marine Saline GradientRFNNSPIGGNRSKSVQNGHTSIHVDADSPFISPGQPGAN*
Ga0153799_100334013300012012FreshwaterSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN*
Ga0181364_101279313300017701Freshwater LakePPVFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0181363_100188913300017707Freshwater LakeKGGRNPPAFRFNNSPIGGNRFKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0181350_103544313300017716Freshwater LakeEEEGDPPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181350_109473723300017716Freshwater LakeSPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181362_109112423300017723Freshwater LakeKEGERNPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0181352_100432713300017747Freshwater LakeCSSDLGVPPAFRFNNSPIGGNRFKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0181352_115335913300017747Freshwater LakeKNPPAFRFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0181356_103264913300017761Freshwater LakeEERNPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGKPGAN
Ga0181358_101452513300017774Freshwater LakeNPPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181358_106689713300017774Freshwater LakeKEEKKGPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0181357_101327243300017777Freshwater LakePPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181349_108308913300017778Freshwater LakeGEIGGPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0181349_108904713300017778Freshwater LakeWRREERDPPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181346_117672523300017780Freshwater LakeALPIWKEESPPAFRFKISPKGANQSKSVQNGHTSIHIDADSPFISPGKPGAN
Ga0181355_132962713300017785Freshwater LakeEKGKKKEGRGPPVFRFNNSPKGANQSKSVQNGHTTIHVDVDSPFISPGQPGAN
Ga0181355_135447013300017785Freshwater LakeDPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0181359_103906913300019784Freshwater LakeGGPPAFRFNNSPIGGNRFKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0181359_108038813300019784Freshwater LakeSPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0211729_1040765023300020172FreshwaterVFLGSASTPPAFRFNNSPKGANQSKSVQNGHTTVHVDADSPFISPGQPGAN
Ga0211729_1040780123300020172FreshwaterVFLGSASTPPAFRFNNSPKGANQSKSVQNGHTTIHVDADSPFINPGQPGAN
Ga0208051_10198213300020488FreshwaterRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0208600_103973613300020550FreshwaterRFNNSPKGANQSKLVQNGHTSIHVDADSPFISPGQPGAN
Ga0222714_1004636513300021961Estuarine WaterRFNNSPIHTNRSESVQNGHTTIHVDADSPFISPGQSGAN
Ga0222714_1042427013300021961Estuarine WaterRFYISPIHTNQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0222713_1000481213300021962Estuarine WaterRFKNSPKGANQSKIVQNGHTTVRIDPDSPFMLPDQSGAN
Ga0222712_1002172663300021963Estuarine WaterRFKNSPKGANQSKIVQNGHTTVRIDPDSPFMLTDQSGAN
Ga0222712_1004691413300021963Estuarine WaterRFNNSPKGANQSKSVQNGHTTVHVDADSPFISPGQSGAN
Ga0222712_1059226623300021963Estuarine WaterRFNNSPKGANQSKSVQNGHTTVHVDADSPFISPGQPGAN
Ga0181353_1000229143300022179Freshwater LakeEKGPPAFRFNNSPIGGNRFKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0181353_103969713300022179Freshwater LakeGKDPPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0181354_108311613300022190Freshwater LakeIGDPPAFRFNNSPKGANQSKSVQNGHTSIHIDADSPFISPGQPGAN
Ga0196905_114880523300022198AqueousNSPKHTNRSESVQNGHTTIHVDADSPFINPSQLGAN
Ga0181351_101635813300022407Freshwater LakeIPPAFRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0214917_10007968133300022752FreshwaterAFSDKNSPKGANQSKLVQNGHTTVRIDADSPFTFPERSGAN
Ga0214917_1002379353300022752FreshwaterRFKNSPKGANQSKIVQNGHTTVRIDPDSPFMLSDQSGAN
Ga0214923_10012431113300023179FreshwaterRFKNSPKGANQSKSVQNGHTTIHVSADSPFISPGQPGAN
Ga0244775_1001170013300024346EstuarineRFKISPKGANQSKSIQNGHTSIHVDADSPFINPGQPGAN
Ga0255185_103393423300024490FreshwaterRFNNSPKHTNRSESVQNGHTTIHVDADSPFISPGQPGAN
Ga0255168_103960913300024506FreshwaterRFKNSPIGGNQSKSVQNGHTTIRIDADSPFISPDQSGAN
Ga0208147_103523323300025635AqueousRFNNSPIGGNQSKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0208147_110351113300025635AqueousRIKNSPIGGNQSKSVQNRHTTIRIDADSPFISPDQSGAN
Ga0208161_101505813300025646AqueousRFNNSPIGGNRSKSVQNGHTLIHVDADSPFINPGQSGAN
Ga0208161_110417913300025646AqueousRFNNSPKHTNRSESVQNGHTTIHVDADSPFINPSQLGAN
Ga0208160_108093623300025647AqueousRFNNSPIGGNRSKSVQNGHTTIHVDADSPFINPGQPGAN
Ga0208795_115305823300025655AqueousRFNNSPKHTNRSESVQNGHTTIHVDADSPFINPGQPGAN
Ga0208898_112689713300025671AqueousRFNNSPIGGNRSKSVQNGHTSIHVDADSPFINPGQSGAN
Ga0208644_112906023300025889AqueousRFNNSPKGANQLKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0208644_113755913300025889AqueousRFNNSPIGGNRSKSVQNGHTLIHVDADSPFINPDQSGAN
Ga0209972_1023724023300027793Freshwater LakeRFNNSPKGANQSKSVQNGHTSIHVDADSPFISPGQPGAN
Ga0209358_1001193083300027804Freshwater LakeRFKISPKGANQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0209985_1001605253300027806Freshwater LakeRFKISPIGGNQSKPVQNGHTTIHVDADSPFISPGQPGAN
Ga0209990_1000314513300027816Freshwater LakeAQRSTPPAFRFKISPIGGNQSKPVQNGHTTIHVDADSPFISPGQPGAN
Ga0209990_1016682123300027816Freshwater LakeRFKISPKGANQSKSVQNGQTTIRVDADSPFINPGQPGAN
(restricted) Ga0247841_10018649113300029286FreshwaterRFNNSPKGANQSKSVQNGHTTIHVDADSPFISSGQPGAN
Ga0307375_1071452113300031669SoilFNISPIHTNQSKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0315907_1010068013300031758FreshwaterPFKISPKSDNQFKSVQNGHTTVRIDQDSPFNTPDQLGAN
Ga0315907_1019856833300031758FreshwaterRLKISPIGGNQSKPVQNGHTTIHVDADSPFISPGQPGAN
Ga0315909_1001014913300031857FreshwaterFLAQVATPPAFRFNNSPKGANQSKSVQNGHTTVHIDADSPFISPGQSGAN
Ga0315909_1003358413300031857FreshwaterRFNNSPKGANQSKSVQNGHTTIHVDANSPFINPGQPGAN
Ga0315909_1008794113300031857FreshwaterRFNNSPKGANQSKSVENGHTTVHVDADSPFISPGQPGAN
Ga0315909_1009745213300031857FreshwaterRFNNSPKGANQSKSVQNGHTIVHVDADSPFISPGQPGAN
Ga0315909_1020866023300031857FreshwaterQFKISPKGANQSKSVQNGQTTIRVDADSPFINPGQPGAN
Ga0315904_1000700813300031951FreshwaterSTPPAFRFNNSPKGANQSKSVQNGHTTVHIDADSPFISPGQSGAN
Ga0315901_1029967623300031963FreshwaterTPPAFRFNNSPKGANQSKSVQNGHTTIHVDANSPFINPGQPGAN
Ga0315902_1042799123300032093FreshwaterRFKISPKGANQSKSVQNGHTTIHVDANSPFINPGQPGAN
Ga0315903_10006296263300032116FreshwaterSFNNSPKGANQSKSVQNGHTTVHIDADSPFISPGQSGAN
Ga0315903_1016652833300032116FreshwaterRFNNSPIHTNRSESVQNGHTTIHVDADSPFISPGQLGAN
Ga0334977_0056995_1_1203300033978FreshwaterRFNNSPKGANQSKSVQNGHTLIHIDADSPFISPGQPGAN
Ga0335001_0054985_2_1633300034064FreshwaterDAVFLGLASTPPAFRFKISPKGANQFKSIQNGHTSIHVDADSPFINPGQPGAN
Ga0310127_082386_2_1183300034072Fracking WaterFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN
Ga0310130_0013433_1_1203300034073Fracking WaterRFNNSPKGANQSKSVQNGHTIIHVDADSPFISPGQPGAN
Ga0310130_0021592_1_1203300034073Fracking WaterRFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQLGAN
Ga0310130_0034531_1428_15473300034073Fracking WaterRFNNSPKGANQSKSVQNGHTLIHVDADSPFINPGQPGAN
Ga0335010_0586426_1_1203300034092FreshwaterRFKISPKGANQSKSVQNGHTLIHVDADSPFINPGQPGAN
Ga0335022_0317369_756_8753300034095FreshwaterRFKISPIGPNESKSVQNGHTSIHVDADSPFINPGQPGAN
Ga0335036_0004461_11791_119283300034106FreshwaterVVAVSLRFNNSPKGANQSKSVQNGHTTIHVDADSPFISPGQPGAN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.