NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094056

Metagenome Family F094056

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094056
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 47 residues
Representative Sequence LALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG
Number of Associated Samples 100
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.89 %
% of genes near scaffold ends (potentially truncated) 98.11 %
% of genes from short scaffolds (< 2000 bps) 82.08 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.264 % of family members)
Environment Ontology (ENVO) Unclassified
(36.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.792 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.21%    β-sheet: 0.00%    Coil/Unstructured: 64.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF06778Chlor_dismutase 73.58
PF13561adh_short_C2 4.72
PF02979NHase_alpha 2.83
PF00226DnaJ 2.83
PF13548DUF4126 1.89
PF14520HHH_5 0.94
PF06368Met_asp_mut_E 0.94
PF00106adh_short 0.94
PF00821PEPCK_GTP 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG3253Coproheme decarboxylase/chlorite dismutaseCoenzyme transport and metabolism [H] 73.58
COG1274Phosphoenolpyruvate carboxykinase, GTP-dependentEnergy production and conversion [C] 0.94
COG4865Glutamate mutase epsilon subunitAmino acid transport and metabolism [E] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS402IJ1YOAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
2199352025|deepsgr__Contig_51057All Organisms → cellular organisms → Bacteria → Proteobacteria953Open in IMG/M
2228664022|INPgaii200_c0270341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300000574|JGI1357J11328_10121456All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1090420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300000890|JGI11643J12802_11621245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300002123|C687J26634_10253653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300002503|C687J35164_10232379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300004009|Ga0055437_10267571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300005171|Ga0066677_10020653All Organisms → cellular organisms → Bacteria3040Open in IMG/M
3300005332|Ga0066388_103360894All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300005356|Ga0070674_100647102All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005518|Ga0070699_102115708All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005543|Ga0070672_101077547All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005568|Ga0066703_10406794All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300005586|Ga0066691_10025981All Organisms → cellular organisms → Bacteria2975Open in IMG/M
3300005618|Ga0068864_102271444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300005764|Ga0066903_103764634All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300005764|Ga0066903_107678983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300005873|Ga0075287_1029164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300005881|Ga0075294_1014499All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300006224|Ga0079037_101557104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300006797|Ga0066659_10034891All Organisms → cellular organisms → Bacteria3048Open in IMG/M
3300006847|Ga0075431_101971979All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006854|Ga0075425_100999317All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300006854|Ga0075425_101119075All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300006871|Ga0075434_100845980All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300006871|Ga0075434_101484174All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300006903|Ga0075426_10658223All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300006930|Ga0079303_10342074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300009094|Ga0111539_10527687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1375Open in IMG/M
3300009148|Ga0105243_10100896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2396Open in IMG/M
3300009157|Ga0105092_10214928All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300009162|Ga0075423_10853063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium964Open in IMG/M
3300009162|Ga0075423_11017562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300009553|Ga0105249_12586723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300010046|Ga0126384_11106449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300010366|Ga0126379_10490255All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300010399|Ga0134127_11772232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium693Open in IMG/M
3300010401|Ga0134121_11746677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300011402|Ga0137356_1043921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300011432|Ga0137428_1013423All Organisms → cellular organisms → Bacteria2074Open in IMG/M
3300011434|Ga0137464_1078531All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300011435|Ga0137426_1002696All Organisms → cellular organisms → Bacteria3961Open in IMG/M
3300012172|Ga0137320_1004201All Organisms → cellular organisms → Bacteria2759Open in IMG/M
3300012203|Ga0137399_11731862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300012207|Ga0137381_10055661All Organisms → cellular organisms → Bacteria → Proteobacteria3276Open in IMG/M
3300012209|Ga0137379_10472920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1162Open in IMG/M
3300012685|Ga0137397_10717467All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300012929|Ga0137404_10489942All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300012948|Ga0126375_11085260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300013307|Ga0157372_10241509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2096Open in IMG/M
3300013760|Ga0120188_1047872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300014263|Ga0075324_1000066All Organisms → cellular organisms → Bacteria → Proteobacteria17860Open in IMG/M
3300014300|Ga0075321_1046278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300014326|Ga0157380_12283154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300014870|Ga0180080_1024643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium886Open in IMG/M
3300014879|Ga0180062_1159606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300014884|Ga0180104_1238030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300014969|Ga0157376_10107738All Organisms → cellular organisms → Bacteria2447Open in IMG/M
3300014969|Ga0157376_10434893All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300015258|Ga0180093_1008353All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300015372|Ga0132256_101728018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300015373|Ga0132257_101619896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium828Open in IMG/M
3300015374|Ga0132255_104768666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300018064|Ga0187773_10324162All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300018066|Ga0184617_1155148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300018072|Ga0184635_10295653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300018075|Ga0184632_10180057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300018084|Ga0184629_10474088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300018429|Ga0190272_12653446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300018469|Ga0190270_12415496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300018476|Ga0190274_11901087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300019377|Ga0190264_10482175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium840Open in IMG/M
3300019881|Ga0193707_1013542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2748Open in IMG/M
3300020001|Ga0193731_1048794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300025160|Ga0209109_10124530All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300025310|Ga0209172_10021189All Organisms → cellular organisms → Bacteria → Proteobacteria4676Open in IMG/M
3300025792|Ga0210143_1105759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300025909|Ga0207705_10999770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300025937|Ga0207669_10637126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium870Open in IMG/M
3300026324|Ga0209470_1152919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1012Open in IMG/M
3300026335|Ga0209804_1029167All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300026535|Ga0256867_10172681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300027252|Ga0209973_1005837All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300027722|Ga0209819_10002925All Organisms → cellular organisms → Bacteria → Proteobacteria5405Open in IMG/M
3300027862|Ga0209701_10535107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300027880|Ga0209481_10039230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2170Open in IMG/M
3300027909|Ga0209382_10924233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium916Open in IMG/M
3300027909|Ga0209382_11490439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300027979|Ga0209705_10330995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium770Open in IMG/M
3300028380|Ga0268265_11780749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300028819|Ga0307296_10805397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300030006|Ga0299907_10100623All Organisms → cellular organisms → Bacteria → Proteobacteria2369Open in IMG/M
3300030619|Ga0268386_10290626All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300031170|Ga0307498_10234292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300031184|Ga0307499_10228686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300031820|Ga0307473_10018455All Organisms → cellular organisms → Bacteria2777Open in IMG/M
3300031946|Ga0310910_10392845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1099Open in IMG/M
3300031965|Ga0326597_11375188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300032003|Ga0310897_10572709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300032174|Ga0307470_10013591All Organisms → cellular organisms → Bacteria3464Open in IMG/M
3300032829|Ga0335070_10617722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1019Open in IMG/M
3300034113|Ga0364937_024684All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300034155|Ga0370498_050499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300034417|Ga0364941_066101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.26%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.32%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.94%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.94%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.94%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.94%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.94%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002123Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3EnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_085401202189573004Grass SoilLVFLALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT
deepsgr_005614002199352025SoilMFNHPIVMIILVLVFLALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAP
INPgaii200_027034122228664022SoilLIFIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGAKPDQPAPTGSPQLG
JGI1357J11328_1012145623300000574GroundwaterFHHPIVMMLLVAGFLALMVWLVPKIFRLAKRGLQALRSKWSGVKPDQPAPSGSSPQPT*
AF_2010_repII_A100DRAFT_109042013300000655Forest SoilMLILIVCFLALVVWLIPKLFRLAKRGLQALRDRLRGVKPDQP
JGI11643J12802_1162124513300000890SoilVAWLVPKIYRLAKRGFQALRDKMRGTKPDHPAASGPSAQPT*
C687J26634_1025365313300002123SoilLVLSFLALVAWLAPKLFRLAKRGFQALRDRLRGVKPDQPAPTGSPQPG*
C687J35164_1023237923300002503SoilSFLALVAWLAPKLFRLAKRGFQALRDRLRGVKPDQPAPTGSPQPG*
Ga0055437_1026757123300004009Natural And Restored WetlandsFVAMCVWLVPKLFRLAKRGFMALRDKLRGVKPDQSAPTGSSAQPT*
Ga0066677_1002065353300005171SoilLVVWLMPKLFRFAKRGFQALRSRMRGAKPDQSPPSSSPQLG*
Ga0066388_10336089423300005332Tropical Forest SoilIWLIPKLFRLAKRGLQALRDRLRGVKPDQPAPTGSPQLG*
Ga0070674_10064710223300005356Miscanthus RhizosphereMFNHPVIMLIVVVLFLAAAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0070699_10211570813300005518Corn, Switchgrass And Miscanthus RhizosphereSIWLIFHHPILMLILIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0070672_10107754713300005543Miscanthus RhizosphereNHPVIMLIVVVLFLAAAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0066703_1040679413300005568SoilHPIVMMILVLVFLALVAWLVPKIYRFAKRGFQALRNKMRGVKPDQPPPKGSSPQPT*
Ga0066691_1002598153300005586SoilVVWLMPKLFRFAKRGFQALRSRMRGAKPDQSPPSSSPQLS*
Ga0068864_10227144413300005618Switchgrass RhizosphereVFRVAKRGYQALRNKLRGVKPDQSTPAGQSPQLT*
Ga0066903_10376463413300005764Tropical Forest SoilLILIVCFLALVVWLIPKLFRLAKRGLQALRNRLRGVNPDQPAPTSSPQLG*
Ga0066903_10767898323300005764Tropical Forest SoilIPKLFRLAKRGLQALRDRLRGVKPDQPAPTGSPQLG*
Ga0075287_102916413300005873Rice Paddy SoilLVAWLVPKFYRLAKRGFQALRDKMRGTKPDHPAPSGPSAQPT*
Ga0075294_101449923300005881Rice Paddy SoilMIILVVSFIALVIWVVPKLFRLAKRGFQTLRARMRGIKPDQSTPTSSPQVS*
Ga0079037_10155710423300006224Freshwater WetlandsVWIVPKIIRMAKRGFQALRDRMRGAKPDQTAPTNGSPPAVANS*
Ga0066659_1003489113300006797SoilPLLMLIVVLGFLALVVWLMPKLFRFAKRGFQALRSRMRGAKPDQSPPSSSPQLG*
Ga0075431_10197197923300006847Populus RhizosphereTVFGSIWLMFHHPVIMIIIVLLFLALAAWIAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0075425_10099931723300006854Populus RhizosphereMLILIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0075425_10111907523300006854Populus RhizosphereVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0075434_10084598023300006871Populus RhizosphereLMLILIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0075434_10148417413300006871Populus RhizosphereNHPILMMILVLIFLALVAWLVPKIYRLAKRGFHALRNKMRGANPDQPAPNGSSPQPT*
Ga0075426_1065822323300006903Populus RhizosphereILVLAFLAMVVWLVPKLFRMAKRGFQALRNRLRGVKPDHPAPTGTPLLS*
Ga0079303_1034207423300006930Deep SubsurfaceKIFRAAKRGFQALRDRMRGAKPDQTSPTSGMPPAAANS*
Ga0111539_1052768733300009094Populus RhizosphereFNHPVIMLIVVVLFLALAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0105243_1010089643300009148Miscanthus RhizosphereWVAPKIYRLAKRGFHALHNKIRGVKPDQPAPNGSSPIPT*
Ga0105092_1021492813300009157Freshwater SedimentFMVLVVWLVPKLFRLAKRGVQALRDRLRGVKSDHPAPTGSPQIG*
Ga0075423_1085306313300009162Populus RhizosphereLIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0075423_1101756223300009162Populus RhizosphereCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0105249_1258672323300009553Switchgrass RhizosphereLVLVFLALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT*
Ga0126384_1110644913300010046Tropical Forest SoilKLFRLAKRGLQALRDRLRGVKPDQPAPTGSPQLG*
Ga0126379_1049025533300010366Tropical Forest SoilWLIPKLFRLAKRGLQALRNRLRGVNPDQPAPTSSPQLG*
Ga0134127_1177223223300010399Terrestrial SoilPRIYRFAKRGFQALRDRMRGTKPDRQAPSGPSAQPT*
Ga0134121_1174667713300010401Terrestrial SoilMLIVVVLFLAVAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0137356_104392123300011402SoilLVVGFLALIVWLTPKLLRLAKRGFQALRDRMRGVKPDQPAPTGSPQLG*
Ga0137428_101342333300011432SoilLALIVWLAPKLFRLAKRGFQALRDRMRGVKPDQPAPTGSPQLG*
Ga0137464_107853113300011434SoilKLFRLAKRGFAALRDKIRGVKPDQSAPTGSSPQPT*
Ga0137426_100269613300011435SoilFVALCFWLVPKLFHLAKRGFVALRDKIRGVKPDQSAPTGSSPQPT*
Ga0137320_100420113300012172SoilAAFVALCVWLVPKLFRLAKRGFAALRDKIRGVKPDQSAPTGSSPQPT*
Ga0137399_1173186223300012203Vadose Zone SoilIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0137381_1005566113300012207Vadose Zone SoilALVVWLMPKLFRFAKRGFQALRSRMRGAKPDQSPPSSSPQLG*
Ga0137379_1047292013300012209Vadose Zone SoilLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0137397_1071746713300012685Vadose Zone SoilLIVCFLALVVWLIPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0137404_1048994213300012929Vadose Zone SoilLIVCFLTLVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG*
Ga0126375_1108526023300012948Tropical Forest SoilMLILIVCFLALVVWLVPKLLRLAKRGLRALRDRLRGVKPDRPAPTGSPQLG*
Ga0157372_1024150943300013307Corn RhizosphereVIMLIVVVLFLAVAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0120188_104787223300013760TerrestrialMMILVLVFLALTVWLLPKLFRFVKRGFQALRDRMRGVKPDQPASTDPPALPT*
Ga0075324_1000066213300014263Natural And Restored WetlandsVVWLVPKIYRLAKRGFQTLREKLRGIKPDQPAPPGSTPQTT*
Ga0075321_104627823300014300Natural And Restored WetlandsFNHPIVMMILVLAFLALMVWLIPKIFRLAKRGFQALRLKMRGVKPDQTAPPGSSAQPM*
Ga0157380_1228315423300014326Switchgrass RhizosphereIMIALVLLFVGLTIWLVPKVFRKAKQGFVALRNRLRGVKPDQPAPGGTPQLS*
Ga0180080_102464313300014870SoilIFNHPVLMLILVLSFLGLVAWLAPKLFRLAKRGFQALRDRLRGVKPDQPAPTGSPQPG*
Ga0180062_115960623300014879SoilVLVVWLVPKLFRLAKRGFQTLRDRLRGVKPDHPAPTGSPQIG*
Ga0180104_123803013300014884SoilILVISFLALVAWLAPKLFRLAKRGFQALRDRLRGVKPDQPAPTGSPQPG*
Ga0157376_1010773853300014969Miscanthus RhizosphereHPVIMLIVVVLFLAAAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT*
Ga0157376_1043489323300014969Miscanthus RhizosphereFNHPVIMIALVLLFVGLTIWLVPKVFLKAKQGFVALRNRLRGVKPDQPAPGGTPQLS*
Ga0180093_100835333300015258SoilVVWLVPKLFRLAKRGFQALRDRLHGVKPDHPAPTGSPQIS*
Ga0132256_10172801823300015372Arabidopsis RhizosphereWLVPKIYRLAKRGFQELRNKMRGVKPDQPAPNGSSPQPT*
Ga0132257_10161989623300015373Arabidopsis RhizosphereLFLALAAWVAPKIYRLAKRGFHALRNKMRGVKPDQPAPNGSSPIPT*
Ga0132255_10476866613300015374Arabidopsis RhizosphereIILVLVFLALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT*
Ga0187773_1032416223300018064Tropical PeatlandIWMIFHHPILMLIFIVCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQL
Ga0184617_115514823300018066Groundwater SedimentIVPKIFRLAKRGFQALRDKMRGAKPDQPTPTDPTALPT
Ga0184635_1029565313300018072Groundwater SedimentPKLLRLAKRGFQALRDRLRGVKPDQPTPTGSPQLG
Ga0184632_1018005723300018075Groundwater SedimentVMIILVLGFFALLVWILPKIFRLAKRGFQALRDKMRGAKPDQPAPTDPTALPT
Ga0184629_1047408823300018084Groundwater SedimentFIALMVWLVPKIFRLAKRGFQALRNKWTGVKPDQPAPSGSSPQPT
Ga0190272_1265344623300018429SoilMFNHPVIMMIPVLVFLALAVWLMPKIFRFVKCGFQALRDRMRGVKPDQPASTTPPALPT
Ga0190270_1241549623300018469SoilMLGLILIFLALVVWLVPRIFRVAKRGYQALRNKLRGVKPDQSTPAGQSPQLT
Ga0190274_1190108723300018476SoilGVWIAPKIFRLAKRGFQALRDRLRGRKPDQTAPSAGPPSAVVNP
Ga0190264_1048217513300019377SoilKIFRLAKRGFQALRDKMRGAKPDQPARNGPSAQPT
Ga0193707_101354253300019881SoilLGLILIFLALVVWLVPKVFRVAKRGYQALRNKLRGVKPDQSTPAGQSPQLT
Ga0193731_104879413300020001SoilKIYRFAKRGFQALRNKMRGVKPDQPPPKGSSPQPT
Ga0209109_1012453013300025160SoilLVLIFTFLALVVWLMPKIYRLAKRGFQALRDKMRGIKPDQPAPPGSTPQTT
Ga0209172_1002118913300025310Hot Spring SedimentHPILMLIFVALFIALCVWLVPKLFRLAKRGFIALRDKLRGVKSGSSASTGSTPQPT
Ga0210143_110575923300025792Natural And Restored WetlandsVVLFIALVAWLMPKIYRFAKRGFQALRDKMRGTKPDHPAPSGPSAQPT
Ga0207705_1099977023300025909Corn RhizosphereVLFLAAAAWVAPKIYRVAKRGFHALRKKIRGVKPDQPAPNGSSPIPT
Ga0207669_1063712613300025937Miscanthus RhizosphereLAAAAWVAPKIYRLAKRGFHALRNKIRGVKPDQPAPNGSSPIPT
Ga0209470_115291913300026324SoilLALLVWIVPKIFRLAKRGFQALRNKLRGVKPDQPASSDPTALPT
Ga0209804_102916753300026335SoilLALVVWLMPKLFRFAKRGFQALRSRMRGAKPDQSPPSSSPQLG
Ga0256867_1017268113300026535SoilLVPKLFRLAKRGFHALRDRLRGVKPDHSTPTGSPQTS
Ga0209973_100583713300027252Arabidopsis Thaliana RhizosphereHPIVMMVLVVLFIALVAWLVPKIYRLAKRGFQALRDKMRGTKPDHPAASGPSAQPT
Ga0209819_1000292513300027722Freshwater SedimentWLIPKLLGMAKRGLQALRDRLRGIKPDQPATTGSPQTG
Ga0209701_1053510713300027862Vadose Zone SoilVPKLFRLAKRGFQALRNRLRGVKPDQPAPTGSPQLS
Ga0209481_1003923043300027880Populus RhizosphereVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG
Ga0209382_1092423313300027909Populus RhizosphereCFLALVVWLVPKLLRLAKRGFQALRDRLRGVKPDQPAPTGSPQLG
Ga0209382_1149043913300027909Populus RhizosphereKLFRLAKRGFAALRDKIRGVKPDQSAPTGSSPQPT
Ga0209705_1033099523300027979Freshwater SedimentLILVVTFLGLVIWLVPKIFRLAKRGFQALRSKLSGLKQDQPPLPDSSPRPT
Ga0268265_1178074913300028380Switchgrass RhizosphereMLGLILIFLALVVWLVPKVFRVAKRGYQALRNKLRGVKPDQTTPAGQSPQLT
Ga0307296_1080539723300028819SoilVWIVPKIFRLAKRGFQALRDKMRGAKPDQPTPTDPTALPT
Ga0299907_1010062353300030006SoilMFNHPVIMMIPVLVFLALAVWLMPKIFRFVKCGFQALRDRMRGVKPDQPTSTNPPALPT
Ga0268386_1029062613300030619SoilFNHPIVMLLILVSFIALVAWLVPKLFRLAKRGFHALRDRLRGVKPDHSTPTGSPQTS
Ga0307498_1023429223300031170SoilALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT
Ga0307499_1022868613300031184SoilLVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT
Ga0307473_1001845513300031820Hardwood Forest SoilPKLLRMAKRGFQALRDRLRGVKPDQPAPTGSPQLG
Ga0310910_1039284513300031946SoilPKIYRLAKRGFHALRNKMRGIKPDQPAPNGSSPLPT
Ga0326597_1137518813300031965SoilFNHPILMLILVLSFLALLAWLAPKLFRLAKRGFQALRDRLRGVKPDQPAPTGSPQPG
Ga0310897_1057270913300032003SoilLVVWLVPKLLRMAKRGLQALRDRLRGVKPDQPTPTGSPQLG
Ga0307470_1001359113300032174Hardwood Forest SoilLMFNHPIVMIILVLVFLALVAWLVPKIYRLAKRGFQALRNKMRGVKPDQPAPNGSSPQPT
Ga0335070_1061772223300032829SoilIWLVPKVFRLAKHGYQALRNRMRGVKPDQATPAGPSPQAT
Ga0364937_024684_2_1513300034113SedimentILVVSFMVLVVWLVPKLFRLAKRGFQALRDRLHGVKPDHPAPTGSPQIS
Ga0370498_050499_1_1413300034155Untreated Peat SoilGLGVWIVPKVFRLAKRGFQALRDRLSGSKPDQTAPNAGPPPAVINS
Ga0364941_066101_3_1253300034417SedimentVVWLVPKLLRLAKRGLQALRDRLRGVKPDQPAPTGSPQLG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.