Metagenome Family F094208

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094208
Family Type	Metagenome
Number of Sequences	106
Average Sequence Length	42 residues
Representative Sequence	QGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Number of Associated Samples	100
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.85 %
% of genes near scaffold ends (potentially truncated)	93.40 %
% of genes from short scaffolds (< 2000 bps)	86.79 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (75.472 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.377 % of family members)
Environment Ontology (ENVO)	Unclassified (19.811 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (49.057 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 17.65% Coil/Unstructured: 82.35%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF13563	2_5_RNA_ligase2	4.72
PF00903	Glyoxalase	3.77
PF07238	PilZ	2.83
PF00464	SHMT	2.83
PF16491	Peptidase_M48_N	2.83
PF04255	DUF433	1.89
PF08281	Sigma70_r4_2	1.89
PF11645	PDDEXK_5	1.89
PF01566	Nramp	1.89
PF00144	Beta-lactamase	1.89
PF00753	Lactamase_B	1.89
PF16694	Cytochrome_P460	1.89
PF12867	DinB_2	1.89
PF11999	Ice_binding	1.89
PF01541	GIY-YIG	0.94
PF01979	Amidohydro_1	0.94
PF11138	DUF2911	0.94
PF10647	Gmad1	0.94
PF01402	RHH_1	0.94
PF00145	DNA_methylase	0.94
PF01828	Peptidase_A4	0.94
PF09844	DUF2071	0.94
PF02527	GidB	0.94
PF13517	FG-GAP_3	0.94
PF09019	EcoRII-C	0.94
PF05988	DUF899	0.94
PF00285	Citrate_synt	0.94
PF03745	DUF309	0.94
PF01548	DEDD_Tnp_IS110	0.94
PF00202	Aminotran_3	0.94
PF13601	HTH_34	0.94
PF13231	PMT_2	0.94
PF03006	HlyIII	0.94
PF04545	Sigma70_r4	0.94
PF04185	Phosphoesterase	0.94
PF10518	TAT_signal	0.94
PF02739	5_3_exonuc_N	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG0112	Glycine/serine hydroxymethyltransferase	Amino acid transport and metabolism [E]	2.83
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	2.83
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	1.89
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.89
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	1.89
COG2367	Beta-lactamase class A	Defense mechanisms [V]	1.89
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	1.89
COG0258	5'-3' exonuclease Xni/ExoIX (flap endonuclease)	Replication, recombination and repair [L]	0.94
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	0.94
COG0357	16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)	Translation, ribosomal structure and biogenesis [J]	0.94
COG0372	Citrate synthase	Energy production and conversion [C]	0.94
COG1272	Predicted membrane channel-forming protein YqfA, hemolysin III family	Intracellular trafficking, secretion, and vesicular transport [U]	0.94
COG1547	Predicted metal-dependent hydrolase	Function unknown [S]	0.94
COG3511	Phospholipase C	Cell wall/membrane/envelope biogenesis [M]	0.94
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.94
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.47 %
Unclassified	root	N/A	24.53 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.47 %
Unclassified	root	N/A	24.53 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.47 %
Unclassified	root	N/A	24.53 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	34.91 %
Unclassified	root	N/A	24.53 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.89 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.89 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	12.26 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.77 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	2.83 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.89 %
unclassified Nitrospirae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae	1.89 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.26 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.77 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	2.83 %
Nitrospirae bacterium 13_2_20CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	1.89 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.89 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.26 %
Gemmatales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales	2.83 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.83 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	1.89 %
Nitrospirae bacterium 13_2_20CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	1.89 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.94 %
Bradymonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales	0.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.26 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	2.83 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.83 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.89 %
Nitrospirae bacterium 13_2_20CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	1.89 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.94 %
Lujinxingiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae	0.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.26 %
Fimbriiglobus	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus	2.83 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.83 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.89 %
Nitrospirae bacterium 13_2_20CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	1.89 %
Lujinxingia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae → Lujinxingia	0.94 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.53 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.26 %
Fimbriiglobus ruber	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber	2.83 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.83 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.89 %
Nitrospirae bacterium 13_2_20CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	1.89 %
Lujinxingia litoralis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae → Lujinxingia → Lujinxingia litoralis	0.94 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001356\|JGI12269J14319_10128919	Not Available	1143	Open in IMG/M
3300001991\|JGI24743J22301_10020046	All Organisms → cellular organisms → Bacteria	1272	Open in IMG/M
3300004080\|Ga0062385_10219752	Not Available	1039	Open in IMG/M
3300005334\|Ga0068869_100287306	All Organisms → cellular organisms → Bacteria	1324	Open in IMG/M
3300005434\|Ga0070709_10111822	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1837	Open in IMG/M
3300005445\|Ga0070708_100182071	All Organisms → cellular organisms → Bacteria	1964	Open in IMG/M
3300005526\|Ga0073909_10361270	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300005542\|Ga0070732_10249522	All Organisms → cellular organisms → Bacteria	1063	Open in IMG/M
3300005542\|Ga0070732_10905464	All Organisms → cellular organisms → Bacteria → Acidobacteria	539	Open in IMG/M
3300005544\|Ga0070686_100123017	All Organisms → cellular organisms → Bacteria	1784	Open in IMG/M
3300005555\|Ga0066692_10294622	All Organisms → cellular organisms → Bacteria → Acidobacteria	1028	Open in IMG/M
3300005591\|Ga0070761_10335977	Not Available	913	Open in IMG/M
3300005591\|Ga0070761_10577173	All Organisms → cellular organisms → Bacteria → Acidobacteria	698	Open in IMG/M
3300005610\|Ga0070763_10550394	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	665	Open in IMG/M
3300005712\|Ga0070764_10397932	All Organisms → cellular organisms → Bacteria → Acidobacteria	813	Open in IMG/M
3300005843\|Ga0068860_100631022	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300006086\|Ga0075019_10511321	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	746	Open in IMG/M
3300006102\|Ga0075015_100181331	All Organisms → cellular organisms → Bacteria	1112	Open in IMG/M
3300006102\|Ga0075015_100895126	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300006175\|Ga0070712_100528885	All Organisms → cellular organisms → Bacteria → Acidobacteria	991	Open in IMG/M
3300006176\|Ga0070765_100088608	All Organisms → cellular organisms → Bacteria	2646	Open in IMG/M
3300006354\|Ga0075021_11046688	Not Available	533	Open in IMG/M
3300006796\|Ga0066665_10467391	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae → Lujinxingia → Lujinxingia litoralis	1038	Open in IMG/M
3300006806\|Ga0079220_11298786	Not Available	609	Open in IMG/M
3300009038\|Ga0099829_10023249	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4295	Open in IMG/M
3300009088\|Ga0099830_10104000	All Organisms → cellular organisms → Bacteria → Acidobacteria	2124	Open in IMG/M
3300009094\|Ga0111539_11439393	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300009520\|Ga0116214_1178476	Not Available	795	Open in IMG/M
3300009522\|Ga0116218_1454070	All Organisms → cellular organisms → Bacteria → Acidobacteria	571	Open in IMG/M
3300010343\|Ga0074044_10747408	Not Available	639	Open in IMG/M
3300010358\|Ga0126370_11846225	Not Available	586	Open in IMG/M
3300010362\|Ga0126377_10462814	All Organisms → cellular organisms → Bacteria	1293	Open in IMG/M
3300010400\|Ga0134122_10044478	All Organisms → cellular organisms → Bacteria	3396	Open in IMG/M
3300010400\|Ga0134122_10279843	Not Available	1423	Open in IMG/M
3300011271\|Ga0137393_10678097	All Organisms → cellular organisms → Bacteria → Acidobacteria	883	Open in IMG/M
3300012198\|Ga0137364_10946688	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300012199\|Ga0137383_10754686	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300012206\|Ga0137380_11572965	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	542	Open in IMG/M
3300012207\|Ga0137381_10744655	All Organisms → cellular organisms → Bacteria → Acidobacteria	851	Open in IMG/M
3300012519\|Ga0157352_1070493	Not Available	564	Open in IMG/M
3300012922\|Ga0137394_10661657	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300012925\|Ga0137419_10523856	Not Available	944	Open in IMG/M
3300012927\|Ga0137416_12222002	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300014154\|Ga0134075_10586058	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	505	Open in IMG/M
3300014155\|Ga0181524_10384259	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300014168\|Ga0181534_10091931	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1513	Open in IMG/M
3300014200\|Ga0181526_10260945	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber	1104	Open in IMG/M
3300014495\|Ga0182015_10055710	All Organisms → cellular organisms → Bacteria	2867	Open in IMG/M
3300014968\|Ga0157379_11940546	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300015373\|Ga0132257_104582931	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300017933\|Ga0187801_10518023	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300017948\|Ga0187847_10236866	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	994	Open in IMG/M
3300018001\|Ga0187815_10125573	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300018007\|Ga0187805_10335284	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300018012\|Ga0187810_10436380	All Organisms → cellular organisms → Bacteria → Acidobacteria	554	Open in IMG/M
3300018042\|Ga0187871_10044271	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	2711	Open in IMG/M
3300018058\|Ga0187766_10988007	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300018431\|Ga0066655_11087574	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	558	Open in IMG/M
3300019890\|Ga0193728_1100110	All Organisms → cellular organisms → Bacteria	1340	Open in IMG/M
3300021170\|Ga0210400_11393150	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300021178\|Ga0210408_10545538	All Organisms → cellular organisms → Bacteria → Acidobacteria	920	Open in IMG/M
3300021406\|Ga0210386_10028301	All Organisms → cellular organisms → Bacteria → Acidobacteria	4393	Open in IMG/M
3300021406\|Ga0210386_11703273	Not Available	521	Open in IMG/M
3300021407\|Ga0210383_11203231	All Organisms → cellular organisms → Bacteria → Acidobacteria	636	Open in IMG/M
3300021418\|Ga0193695_1121614	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300021420\|Ga0210394_11020322	Not Available	716	Open in IMG/M
3300021433\|Ga0210391_10340798	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber	1176	Open in IMG/M
3300021477\|Ga0210398_10362076	Not Available	1182	Open in IMG/M
3300021478\|Ga0210402_10793844	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	872	Open in IMG/M
3300025414\|Ga0208935_1040026	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	623	Open in IMG/M
3300025906\|Ga0207699_10515763	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	864	Open in IMG/M
3300025916\|Ga0207663_10580531	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	879	Open in IMG/M
3300025928\|Ga0207700_10912591	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	786	Open in IMG/M
3300025942\|Ga0207689_11502371	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300026041\|Ga0207639_10194880	All Organisms → cellular organisms → Bacteria	1733	Open in IMG/M
3300026331\|Ga0209267_1225228	All Organisms → cellular organisms → Bacteria → Acidobacteria	692	Open in IMG/M
3300026538\|Ga0209056_10373869	Not Available	910	Open in IMG/M
3300027432\|Ga0209421_1138033	Not Available	503	Open in IMG/M
3300027604\|Ga0208324_1044257	All Organisms → cellular organisms → Bacteria	1309	Open in IMG/M
3300027641\|Ga0208827_1110792	Not Available	803	Open in IMG/M
3300027701\|Ga0209447_10221045	Not Available	516	Open in IMG/M
3300027842\|Ga0209580_10149695	Not Available	1148	Open in IMG/M
3300027853\|Ga0209274_10250059	Not Available	907	Open in IMG/M
3300027879\|Ga0209169_10255165	All Organisms → cellular organisms → Bacteria → Acidobacteria	919	Open in IMG/M
3300027882\|Ga0209590_10862637	All Organisms → cellular organisms → Bacteria → Acidobacteria	572	Open in IMG/M
3300027884\|Ga0209275_10027054	All Organisms → cellular organisms → Bacteria	2616	Open in IMG/M
3300027889\|Ga0209380_10372377	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	838	Open in IMG/M
3300027905\|Ga0209415_10352030	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber	1225	Open in IMG/M
3300028015\|Ga0265353_1017888	All Organisms → cellular organisms → Bacteria → Acidobacteria	677	Open in IMG/M
3300028745\|Ga0302267_10005291	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	13628	Open in IMG/M
3300028906\|Ga0308309_10152514	All Organisms → cellular organisms → Bacteria → Acidobacteria	1861	Open in IMG/M
3300029943\|Ga0311340_10919882	Not Available	726	Open in IMG/M
3300030007\|Ga0311338_10175768	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	2505	Open in IMG/M
3300030044\|Ga0302281_10018577	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4059	Open in IMG/M
3300030399\|Ga0311353_11501079	All Organisms → cellular organisms → Bacteria → Acidobacteria	546	Open in IMG/M
3300031231\|Ga0170824_111916606	Not Available	1017	Open in IMG/M
3300031708\|Ga0310686_111246300	All Organisms → cellular organisms → Bacteria	1536	Open in IMG/M
3300031708\|Ga0310686_111658287	Not Available	550	Open in IMG/M
3300031715\|Ga0307476_10925435	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	643	Open in IMG/M
3300032160\|Ga0311301_10121266	All Organisms → cellular organisms → Bacteria	4929	Open in IMG/M
3300032180\|Ga0307471_102721786	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300032783\|Ga0335079_11940426	Not Available	569	Open in IMG/M
3300033806\|Ga0314865_051362	All Organisms → cellular organisms → Bacteria → Acidobacteria	1061	Open in IMG/M
3300034163\|Ga0370515_0081682	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1403	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.45%
Host-Associated	Host-Associated	7.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.36%
Aquatic	Environmental → Aquatic	15.09%
Plants	Host-Associated → Plants	7.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	72.64%
Freshwater	Environmental → Aquatic → Freshwater	11.32%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.66%
Peat	Environmental → Terrestrial → Peat	4.72%
Sediment	Environmental → Aquatic → Sediment	3.77%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.00%
Loam	Environmental → Terrestrial → Soil → Loam	16.98%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	11.32%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.66%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.72%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.21%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.38%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	6.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.60%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.72%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.72%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.77%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.94%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.38%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	9.43%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	6.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.72%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	3.77%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.77%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.77%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	2.83%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.83%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.89%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.89%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.94%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.94%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.94%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.94%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.94%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.94%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.94%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.94%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.94%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.94%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001356	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007	Environmental	Open in IMG/M
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated	Open in IMG/M
3300004080	Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental	Open in IMG/M
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012519	Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014155	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG	Environmental	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental	Open in IMG/M
3300018001	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300025414	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027432	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)	Environmental	Open in IMG/M
3300027604	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)	Environmental	Open in IMG/M
3300027641	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)	Environmental	Open in IMG/M
3300027701	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027853	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)	Environmental	Open in IMG/M
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300028015	Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6	Environmental	Open in IMG/M
3300028745	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029943	I_Palsa_N3 coassembly	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030044	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2	Environmental	Open in IMG/M
3300030399	II_Palsa_E2 coassembly	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033806	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20	Environmental	Open in IMG/M
3300034163	Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12269J14319_101289193	3300001356	Peatlands Soil	PMPGHFKSGDSKWLPANYSHTITNTGTKAAKFVTLEFP*
JGI24743J22301_100200462	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	PMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR*
Ga0062385_102197521	3300004080	Bog Forest Soil	SPRQASMATHLKSGDSKWLPANYSRTINTGAKPAKFVTLEFP*
Ga0068869_1002873061	3300005334	Miscanthus Rhizosphere	DVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK*
Ga0070709_101118221	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	RSDVEGQGPMPGKFMAGDAKWLPGGYSHTLTNTGKQTARFITFEFP*
Ga0070708_1001820714	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	GMVPMPGRFKSGDVKWLPGGYTHTLTNVGRSPAKFVTVEFPAK*
Ga0073909_103612703	3300005526	Surface Soil	FKSGDVKWLPGGYTHTLTNVGKSAAKFVTVEFPGK*
Ga0070732_102495221	3300005542	Surface Soil	PMPGHLKSGDVKWLPGDYTHTLTNVGKQEAKFVTLEFH*
Ga0070732_109054641	3300005542	Surface Soil	LQMRSDVVGQGPMPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTLEFH*
Ga0070686_1001230173	3300005544	Switchgrass Rhizosphere	DLRSDVEGQGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR*
Ga0066692_102946221	3300005555	Soil	SDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQAAKFVTLEFQ*
Ga0070761_103359772	3300005591	Soil	IRSDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP*
Ga0070761_105771732	3300005591	Soil	DVEGKGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH*
Ga0070763_105503941	3300005610	Soil	DIVGQGPMPGIFKSGDVKWLAGGYTHTLTNVSNQPAKFVTLEFH*
Ga0070764_103979321	3300005712	Soil	IRSDVQSQGSMPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP*
Ga0068860_1006310221	3300005843	Switchgrass Rhizosphere	EGQGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR*
Ga0075019_105113212	3300006086	Watersheds	LDLRSDVEGKGSMPGKFKSGDIKWVPGNYTHTLTNTGKQPARFVTLEF*
Ga0075015_1001813314	3300006102	Watersheds	LDLRSDVEGKGPMPGKFKSGDVKWVPGGYTHTVTNVAKSPARFVTVEF*
Ga0075015_1008951261	3300006102	Watersheds	PISVKIKAGDVRWVPGGYTHTLTNTGQQEAWFITLEF*
Ga0070712_1005288852	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	QGPMPGHFKAGDIKWIPGGYTHTLTNTGKQSARFVAVEFP*
Ga0070765_1000886081	3300006176	Soil	RSDVEGMGPMPGKFKSGDVKGLPGGNTHTLTNEGKSPARFVTVEL*
Ga0075021_110466881	3300006354	Watersheds	MPGHIKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFQ*
Ga0066665_104673911	3300006796	Soil	AGQGPVPGHFKSGDTKWLPGGYTHTLTNTGKQPARFITLEFPAEKTTK*
Ga0079220_112987862	3300006806	Agricultural Soil	RSVGEGQSSTLTKLKSGDVKWLPGGYTHTLSNAAKQPAKFITLEFPQ*
Ga0099829_100232491	3300009038	Vadose Zone Soil	GPNSGPMPAHFKSGDSKWLPGSYSHTITNTGAKPAKFVTLEFP*
Ga0099830_101040005	3300009088	Vadose Zone Soil	EGMGPMPGHFKSGDVKWLPGGYSHTLTNVGKSNAKFITLEFP*
Ga0111539_114393931	3300009094	Populus Rhizosphere	QGPMPGKFKSGDSKWLPGGYTHTLTNAGKQPAKFITLEFPR*
Ga0116214_11784762	3300009520	Peatlands Soil	GHFKSGEVKWLPGGYTHTLTNVGKQQAKFVTLEFQ*
Ga0116218_14540702	3300009522	Peatlands Soil	LDVRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQEAKFVTLEFH*
Ga0074044_107474081	3300010343	Bog Forest Soil	PPSHFKSGDHKWLPASDSSAITNPSPKPAKFVTLEFP*
Ga0126370_118462252	3300010358	Tropical Forest Soil	LDIRSDIEGAGPMPGKFKSGDVKWLRGGYTHTLTNTGSAVAKLVTVEFK*
Ga0126377_104628141	3300010362	Tropical Forest Soil	DVAGKSPMPGHFKAGESKWIPGGYTHTLTNAGKQPAKFVTLEFH*
Ga0134122_100444781	3300010400	Terrestrial Soil	QGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR*
Ga0134122_102798432	3300010400	Terrestrial Soil	MPGKFKAGDVKWLPGGYTHTLTNTAKSTARLVTVEFKP*
Ga0137393_106780972	3300011271	Vadose Zone Soil	GQLKSGEVKWLPGGYTHTLTNVGKQPAKFITLEFH*
Ga0137364_109466882	3300012198	Vadose Zone Soil	GPMLGYFKSGDVKWLPGGYSHTLTNVGKAEAKFITLEFH*
Ga0137383_107546862	3300012199	Vadose Zone Soil	EIRSDVVGQGPMPGHFKSGDVKWLPGGYSHTLTNVGKTEAKFITLEFH*
Ga0137380_115729651	3300012206	Vadose Zone Soil	VGPMPGKFKSGDVKWLPGGYTHTLTNVGNSPAKFVTVEFPGK*
Ga0137381_107446553	3300012207	Vadose Zone Soil	PAPAQLKSGDAKWLPGSYTHTLTNTGKQPAKFVTVEFP*
Ga0157352_10704931	3300012519	Unplanted Soil	KGPMPVKLKSGDSKWLAGGYTHTLTNTGKQPAKFITLEFPK*
Ga0137394_106616571	3300012922	Vadose Zone Soil	MPGHFKSGDSKWLPGNYSHTITNVGKHPAKFMTLQFP*
Ga0137419_105238561	3300012925	Vadose Zone Soil	PMPGHFKSGESKWLPGGYSHTITNVGRLPAKFVTVEFP*
Ga0137416_122220022	3300012927	Vadose Zone Soil	RSDVEGMGPMPGKFKSSDVKWLPGGYTHTLTNVGKSAVKFVTVEFPGN*
Ga0134075_105860581	3300014154	Grasslands Soil	GPMPGKFKSGDVKWLPGGYTHTLTNVGNSPAKFVTVEFPGK*
Ga0181524_103842592	3300014155	Bog	DVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH*
Ga0181534_100919313	3300014168	Bog	FMSGQVKWLPGGYSHTLTNTGKTPAKFVTLEFPAGTPK*
Ga0181526_102609453	3300014200	Bog	DVEGQGSMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH*
Ga0182015_100557103	3300014495	Palsa	MDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP*
Ga0157379_119405461	3300014968	Switchgrass Rhizosphere	RSDVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK*
Ga0132257_1045829312	3300015373	Arabidopsis Rhizosphere	EGKGPMPGHFKAGESKWIPGGYTHTLTNVGKEPAKFVTLEFH*
Ga0187801_105180232	3300017933	Freshwater Sediment	EGMGPMPGKLKAGDVKWLPGGYTHTLTNTGARPARFVTVEF
Ga0187847_102368661	3300017948	Peatland	MPGKFKSGDIKWLPGGYTHTLTNVGQSPARFVTVEF
Ga0187815_101255732	3300018001	Freshwater Sediment	EIRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Ga0187805_103352842	3300018007	Freshwater Sediment	DVELRSDVEGKGPMPGKFKSGDVKWLPGDYTHTLTNTSKQTARFVIVEF
Ga0187810_104363801	3300018012	Freshwater Sediment	GQGPMPGKFKSGDVKWLPGGYTHTVTNVGKSLARLVTVEF
Ga0187871_100442711	3300018042	Peatland	FMSGQVKWLPGGYSHTLTNTGKTPAKFVTLEFPAGTPK
Ga0187766_109880071	3300018058	Tropical Peatland	PMPAKLKAGDVKWVPGGFTHTLTNTGTLGARLVTVEFAEAKE
Ga0066655_110875742	3300018431	Grasslands Soil	GQGPMPGRFKSGDVKWLPGGYTHTLTNTGKAPARLVTVEFK
Ga0193728_11001102	3300019890	Soil	DVVGQGPMLGYFKSGDVKWLPGGYSHTLTNVGKAEAKFITLEFH
Ga0210400_113931502	3300021170	Soil	RSQPGHFKSGDSKWFPGGYWRAVTNVGHNPAKYVILEFP
Ga0210408_105455382	3300021178	Soil	MPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTMEFH
Ga0210386_100283011	3300021406	Soil	EGQGPMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKLVTLEFQ
Ga0210386_117032731	3300021406	Soil	VNFKSGDAKWLPGGYIHTLTNISNQEAKFVTLEFH
Ga0210383_112032312	3300021407	Soil	LEIRSDVEGKGPMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKLVTLEFQ
Ga0193695_11216142	3300021418	Soil	DLEIRSDVVGQGPMLGYFKSGDVKWLPGGYSHTLTNLGKAEAKFITLEFH
Ga0210394_110203223	3300021420	Soil	VEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP
Ga0210391_103407983	3300021433	Soil	PMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Ga0210398_103620762	3300021477	Soil	IRSDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTATKPAKFVTLEFP
Ga0210402_107938441	3300021478	Soil	PTLGHLKSGEVKWLPGGYTHTLTNVGKQDAKFVTLEFH
Ga0208935_10400261	3300025414	Peatland	IRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Ga0207699_105157631	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	VRSDVEGQGPMPGKFMAGDAKWLPGGYSHTLTNTGKQTARFITFEFP
Ga0207663_105805312	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	GEVKWLPGDYTHTLTNTGKSVAKFVILEFPPSANAK
Ga0207700_109125911	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	GSGPMPGKFKAGDIKWLPGGYTHTLTNVGKDSARFITLEF
Ga0207689_115023711	3300025942	Miscanthus Rhizosphere	DVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK
Ga0207639_101948801	3300026041	Corn Rhizosphere	PGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR
Ga0209267_12252281	3300026331	Soil	DLEVRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQAAKFVTLEFQ
Ga0209056_103738691	3300026538	Soil	GHFKSGDTKWLPGGYTHTLTNTGKQPARFITLEFPAEKTTK
Ga0209421_11380331	3300027432	Forest Soil	VSDVYLRSDTPRQASVATHLKSGDSKWLPANYSRTINTGTKAAKFVTLEFP
Ga0208324_10442573	3300027604	Peatlands Soil	VPMSAHFKPGDVQWLPAGLTHTLTNTAHTPAKFVTLEFH
Ga0208827_11107921	3300027641	Peatlands Soil	GHFKSGDFKWLPGGYTHTLTNVGKQEAKFVTLEFH
Ga0209447_102210451	3300027701	Bog Forest Soil	SGEVEWIPGGVTHSLTNIGKQQAKFVTLEFHDPKELL
Ga0209580_101496951	3300027842	Surface Soil	GKGPMPGHLKSGDVKWLPGDYTHTLTNVGKQEAKFVTLEFH
Ga0209274_102500591	3300027853	Soil	SDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP
Ga0209169_102551652	3300027879	Soil	MPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP
Ga0209590_108626372	3300027882	Vadose Zone Soil	MPGHFKSADVKWLPGGYSHTVTNVGKSEAKFITLEFH
Ga0209275_100270544	3300027884	Soil	QGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Ga0209380_103723771	3300027889	Soil	GSAPTAEKLKAGEVKWLPGGYTHTVTNVGKTPARIVAVEF
Ga0209415_103520303	3300027905	Peatlands Soil	PMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH
Ga0265353_10178882	3300028015	Soil	SDVQSQGSMPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP
Ga0302267_1000529118	3300028745	Bog	APTLAKFKSGEIKWLPGGYTHTVTNVGKSPARLVTVEF
Ga0308309_101525143	3300028906	Soil	SHPASHMKSGDSKWLPGNITHTVTNTGTKPAKFVTLEFP
Ga0311340_109198821	3300029943	Palsa	MDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP
Ga0311338_101757681	3300030007	Palsa	VHGMDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP
Ga0302281_100185771	3300030044	Fen	RAPTLAKFKSGEIKWLPGGYTHTVTNVGKSPARLVTVEF
Ga0311353_115010791	3300030399	Palsa	DIRSDVEGQIPMLGHFKSGDSKWLPGGYSHSITNAGAAPAKFVTLEFP
Ga0170824_1119166061	3300031231	Forest Soil	DVEGQGPNSGPMPAHFKSGDSKWLPGNYSHTLTNTGAKPARFVTLEFP
Ga0310686_1112463001	3300031708	Soil	PMPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTLEFH
Ga0310686_1116582871	3300031708	Soil	DLGHFMSGQVQWLPGDYSQTITNTGKTKAKFVTLEFPPQSK
Ga0307476_109254353	3300031715	Hardwood Forest Soil	GQGPMPGKFKAGDIKWLPGGYTHTLTNVGKNPARMVTVEF
Ga0318501_102419703	3300031736	Soil	RSDVQGRGPSTVQLKAGDIKWVPGGYTHTLTNTGKQAAKFVAVEFP
Ga0311301_101212662	3300032160	Peatlands Soil	MPAHLKSGEYKWLPGNYSHTITNIGSKPAKFVTLEFP
Ga0307471_1027217862	3300032180	Hardwood Forest Soil	SDVVGQGPMLGYFKSGDVKWSPGGYSHTLTNVGKAEAKFITLEFH
Ga0335079_119404261	3300032783	Soil	VEGRGPMPEHLKAGEVKWLPGGYTHTVTNMSKQPAKIVTLEFQP
Ga0310914_103444841	3300033289	Soil	SDVQGRGPSTVQLKAGDIKWVPGGYTHTLTNTGKQAAKFVAVEFP
Ga0314865_051362_478_603	3300033806	Peatland	MPAKLKAGDVKWVPGGFTHTLTNTGTSVARLVTVEFAGAKE
Ga0370515_0081682_1216_1347	3300034163	Untreated Peat Soil	MERKSPKPGHFKSGDSKWLPANYSHTLANTGTKPAKFVTLEFP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094208

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences