Metagenome / Metatranscriptome Family F094325

Basic Information
Family ID	F094325
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	39 residues
Representative Sequence	RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Number of Associated Samples	92
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	11.32 %
% of genes near scaffold ends (potentially truncated)	60.38 %
% of genes from short scaffolds (< 2000 bps)	92.45 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (70.755 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.094 % of family members)
Environment Ontology (ENVO)	Unclassified (29.245 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (48.113 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF00296	Bac_luciferase	6.60
PF06439	3keto-disac_hyd	6.60
PF13472	Lipase_GDSL_2	2.83
PF03401	TctC	1.89
PF04248	NTP_transf_9	1.89
PF03459	TOBE	1.89
PF00072	Response_reg	0.94
PF00497	SBP_bac_3	0.94
PF04392	ABC_sub_bind	0.94
PF12071	DUF3551	0.94
PF04055	Radical_SAM	0.94
PF13565	HTH_32	0.94
PF00872	Transposase_mut	0.94
PF00144	Beta-lactamase	0.94
PF02265	S1-P1_nuclease	0.94
PF00580	UvrD-helicase	0.94
PF01610	DDE_Tnp_ISL3	0.94
PF04311	DUF459	0.94
PF07883	Cupin_2	0.94
PF13367	PrsW-protease	0.94
PF02769	AIRS_C	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	6.60
COG2343	Uncharacterized conserved protein, DUF427 family	Function unknown [S]	1.89
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.89
COG0210	Superfamily I DNA or RNA helicase	Replication, recombination and repair [L]	0.94
COG1074	3Ã¢â‚¬â„¢-5Ã¢â‚¬â„¢ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.94
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.94
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.94
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.94
COG2845	Peptidoglycan O-acetyltransferase, SGNH hydrolase family	Cell wall/membrane/envelope biogenesis [M]	0.94
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.94
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.94
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.94
COG3973	DNA helicase IV	Replication, recombination and repair [L]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.75 %
Unclassified	root	N/A	29.25 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.75 %
Unclassified	root	N/A	29.25 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.75 %
Unclassified	root	N/A	29.25 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	66.04 %
Unclassified	root	N/A	29.25 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.94 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	56.60 %
Unclassified	root	N/A	29.25 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	35.85 %
Unclassified	root	N/A	29.25 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8.49 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.89 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.66 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1.89 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.83 %
unclassified Bradyrhizobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae	1.89 %
Craurococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.94 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples	0.94 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	34.91 %
Unclassified	root	N/A	29.25 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
uncultured Craurococcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.	0.94 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.94 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.94 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100577334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1282	Open in IMG/M
3300000837\|AP72_2010_repI_A100DRAFT_1002279	All Organisms → cellular organisms → Bacteria → Proteobacteria	2716	Open in IMG/M
3300002909\|JGI25388J43891_1066659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547	Open in IMG/M
3300002910\|JGI25615J43890_1095152	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300005332\|Ga0066388_102715254	Not Available	904	Open in IMG/M
3300005468\|Ga0070707_100732958	All Organisms → cellular organisms → Bacteria → Proteobacteria	952	Open in IMG/M
3300005471\|Ga0070698_101483043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	629	Open in IMG/M
3300005553\|Ga0066695_10532889	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300005562\|Ga0058697_10609692	Not Available	571	Open in IMG/M
3300005616\|Ga0068852_100073530	All Organisms → cellular organisms → Bacteria → Proteobacteria	3007	Open in IMG/M
3300005618\|Ga0068864_100600620	Not Available	1068	Open in IMG/M
3300005713\|Ga0066905_100195630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1506	Open in IMG/M
3300005764\|Ga0066903_101079618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1477	Open in IMG/M
3300005764\|Ga0066903_101914442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1136	Open in IMG/M
3300005764\|Ga0066903_104659898	Not Available	730	Open in IMG/M
3300005764\|Ga0066903_106554259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300005764\|Ga0066903_106670978	Not Available	600	Open in IMG/M
3300005764\|Ga0066903_108125393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537	Open in IMG/M
3300006028\|Ga0070717_10729656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	900	Open in IMG/M
3300006038\|Ga0075365_11061616	Not Available	570	Open in IMG/M
3300006172\|Ga0075018_10654419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564	Open in IMG/M
3300006573\|Ga0074055_10011012	Not Available	867	Open in IMG/M
3300006904\|Ga0075424_100146997	All Organisms → cellular organisms → Bacteria → Proteobacteria	2496	Open in IMG/M
3300006914\|Ga0075436_100335087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1089	Open in IMG/M
3300007255\|Ga0099791_10002737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7159	Open in IMG/M
3300009088\|Ga0099830_10050101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2943	Open in IMG/M
3300009090\|Ga0099827_10280762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1405	Open in IMG/M
3300009137\|Ga0066709_101250723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1091	Open in IMG/M
3300009148\|Ga0105243_12259528	Not Available	581	Open in IMG/M
3300009162\|Ga0075423_11561521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	709	Open in IMG/M
3300009176\|Ga0105242_11254863	Not Available	763	Open in IMG/M
3300009792\|Ga0126374_10068631	Not Available	1886	Open in IMG/M
3300009792\|Ga0126374_10549265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	843	Open in IMG/M
3300010043\|Ga0126380_11757016	Not Available	559	Open in IMG/M
3300010046\|Ga0126384_10684385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	907	Open in IMG/M
3300010359\|Ga0126376_10204177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1640	Open in IMG/M
3300010360\|Ga0126372_11004138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.	846	Open in IMG/M
3300010366\|Ga0126379_10395442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1428	Open in IMG/M
3300010366\|Ga0126379_10536335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1248	Open in IMG/M
3300010366\|Ga0126379_11463129	Not Available	789	Open in IMG/M
3300010373\|Ga0134128_13081479	Not Available	512	Open in IMG/M
3300010376\|Ga0126381_102612267	Not Available	723	Open in IMG/M
3300010376\|Ga0126381_103360863	Not Available	630	Open in IMG/M
3300010398\|Ga0126383_10747079	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1059	Open in IMG/M
3300010398\|Ga0126383_13523382	Not Available	511	Open in IMG/M
3300011106\|Ga0151489_1604134	Not Available	673	Open in IMG/M
3300012180\|Ga0153974_1051166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	907	Open in IMG/M
3300012198\|Ga0137364_10579815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	845	Open in IMG/M
3300012201\|Ga0137365_10857275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	663	Open in IMG/M
3300012208\|Ga0137376_10310207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1369	Open in IMG/M
3300012349\|Ga0137387_10892183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643	Open in IMG/M
3300012361\|Ga0137360_10618822	Not Available	927	Open in IMG/M
3300012917\|Ga0137395_10157785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1557	Open in IMG/M
3300012929\|Ga0137404_12053033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534	Open in IMG/M
3300012929\|Ga0137404_12142746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	522	Open in IMG/M
3300012955\|Ga0164298_11599883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	513	Open in IMG/M
3300012960\|Ga0164301_10773014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	731	Open in IMG/M
3300012976\|Ga0134076_10036604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1810	Open in IMG/M
3300014325\|Ga0163163_12418695	Not Available	584	Open in IMG/M
3300014969\|Ga0157376_13107095	Not Available	503	Open in IMG/M
3300015264\|Ga0137403_10559758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1011	Open in IMG/M
3300015371\|Ga0132258_10653778	All Organisms → cellular organisms → Bacteria → Proteobacteria	2643	Open in IMG/M
3300015371\|Ga0132258_11543135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1677	Open in IMG/M
3300016422\|Ga0182039_11164406	Not Available	696	Open in IMG/M
3300016445\|Ga0182038_11397943	All Organisms → cellular organisms → Bacteria → Proteobacteria	627	Open in IMG/M
3300018468\|Ga0066662_11762363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	648	Open in IMG/M
3300021078\|Ga0210381_10404285	Not Available	505	Open in IMG/M
3300021444\|Ga0213878_10181426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	881	Open in IMG/M
3300021560\|Ga0126371_12462069	Not Available	630	Open in IMG/M
3300022530\|Ga0242658_1123457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	643	Open in IMG/M
3300022531\|Ga0242660_1230460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300022533\|Ga0242662_10330278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300022726\|Ga0242654_10384368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	535	Open in IMG/M
3300025910\|Ga0207684_10023821	All Organisms → cellular organisms → Bacteria	5224	Open in IMG/M
3300025910\|Ga0207684_10182593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1809	Open in IMG/M
3300025920\|Ga0207649_11586390	Not Available	518	Open in IMG/M
3300025931\|Ga0207644_10082951	All Organisms → cellular organisms → Bacteria → Proteobacteria	2372	Open in IMG/M
3300026095\|Ga0207676_11014286	Not Available	818	Open in IMG/M
3300027061\|Ga0209729_1041354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	582	Open in IMG/M
3300027502\|Ga0209622_1091863	All Organisms → cellular organisms → Bacteria → Proteobacteria	556	Open in IMG/M
3300027654\|Ga0209799_1010585	All Organisms → cellular organisms → Bacteria	1976	Open in IMG/M
3300027846\|Ga0209180_10449830	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	726	Open in IMG/M
3300027903\|Ga0209488_10332121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1132	Open in IMG/M
3300027909\|Ga0209382_12117925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	535	Open in IMG/M
3300028592\|Ga0247822_10737332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	799	Open in IMG/M
3300028711\|Ga0307293_10019772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1971	Open in IMG/M
3300028768\|Ga0307280_10034176	All Organisms → cellular organisms → Bacteria → Proteobacteria	1533	Open in IMG/M
3300028811\|Ga0307292_10194094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	832	Open in IMG/M
3300028824\|Ga0307310_10442214	Not Available	650	Open in IMG/M
3300028878\|Ga0307278_10379088	Not Available	622	Open in IMG/M
3300031226\|Ga0307497_10076817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	1245	Open in IMG/M
3300031545\|Ga0318541_10268440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	949	Open in IMG/M
3300031765\|Ga0318554_10119019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1490	Open in IMG/M
3300031777\|Ga0318543_10157036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1001	Open in IMG/M
3300031777\|Ga0318543_10283668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	740	Open in IMG/M
3300031782\|Ga0318552_10357039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	744	Open in IMG/M
3300031832\|Ga0318499_10082648	Not Available	1232	Open in IMG/M
3300031947\|Ga0310909_11021839	Not Available	674	Open in IMG/M
3300032008\|Ga0318562_10260244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1008	Open in IMG/M
3300032055\|Ga0318575_10405351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	692	Open in IMG/M
3300032059\|Ga0318533_10820349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683	Open in IMG/M
3300032067\|Ga0318524_10747336	Not Available	516	Open in IMG/M
3300032174\|Ga0307470_10332148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1046	Open in IMG/M
3300032180\|Ga0307471_100384635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1525	Open in IMG/M
3300032261\|Ga0306920_102889999	Not Available	651	Open in IMG/M
3300033290\|Ga0318519_10911496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.02%
Host-Associated	Host-Associated	16.98%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.13%
Plants	Host-Associated → Plants	16.04%
Aquatic	Environmental → Aquatic	1.89%
Fungi	Host-Associated → Fungi	0.94%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.49%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.72%
Roots	Host-Associated → Plants → Roots	1.89%
Freshwater	Environmental → Aquatic → Freshwater	0.94%
Sediment	Environmental → Aquatic → Sediment	0.94%
Phylloplane	Host-Associated → Plants → Phylloplane	0.94%
Mycelium	Host-Associated → Fungi → Mycelium	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.04%
Loam	Environmental → Terrestrial → Soil → Loam	15.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.60%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.94%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	38.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	20.75%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.60%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.94%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.94%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.94%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.09%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.77%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.89%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.94%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.94%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.94%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.94%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.94%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.94%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental	Open in IMG/M
3300002909	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm	Environmental	Open in IMG/M
3300002910	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027061	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027502	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental	Open in IMG/M
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F094325

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1005773343	3300000364	Soil	MLWVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
AP72_2010_repI_A100DRAFT_10022791	3300000837	Forest Soil	LRIRPPLTLGWEVEMSERRITQLFGPIPGAIVSCTMVLNAFAF*
JGI25388J43891_10666592	3300002909	Grasslands Soil	GYNQSQRMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
JGI25615J43890_10951521	3300002910	Grasslands Soil	VQPTQRMAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0066388_1027152542	3300005332	Tropical Forest Soil	MRQMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0070707_1007329582	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0070698_1014830432	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0066695_105328891	3300005553	Soil	ALERRLAMSERKITQLFGLILGALFTCTLVLNAFAF*
Ga0058697_106096922	3300005562	Agave	MLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0068852_1000735301	3300005616	Corn Rhizosphere	SVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0068864_1006006201	3300005618	Switchgrass Rhizosphere	LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0066905_1001956301	3300005713	Tropical Forest Soil	MGVLDMSERRITQLFGLILGALVTCTLVLNAFAF*
Ga0066903_1010796183	3300005764	Tropical Forest Soil	MLAHATNVRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0066903_1019144423	3300005764	Tropical Forest Soil	MREIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0066903_1046598981	3300005764	Tropical Forest Soil	MLYRQEGAMSERRITQVFGLALGAIFTCALVLNAFAY*
Ga0066903_1065542592	3300005764	Tropical Forest Soil	LGWEIEMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0066903_1066709782	3300005764	Tropical Forest Soil	TNQRDRELTMTERRITRLVGLALGALFTCGLILNAFAF*
Ga0066903_1081253931	3300005764	Tropical Forest Soil	RLGWEVEMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0070717_107296561	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0075365_110616161	3300006038	Populus Endosphere	VLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075018_106544191	3300006172	Watersheds	GWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0074055_100110122	3300006573	Soil	NRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075424_1001469974	3300006904	Populus Rhizosphere	LEREAEMSERRITQLFGLILGALFTCTLVLNAFAF*
Ga0075436_1003350872	3300006914	Populus Rhizosphere	MANRLGWELEMSERRITQVFGLVLGAITTCTMVLNAFAF*
Ga0099791_100027374	3300007255	Vadose Zone Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0099830_100501015	3300009088	Vadose Zone Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNALAF*
Ga0099827_102807622	3300009090	Vadose Zone Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0066709_1012507232	3300009137	Grasslands Soil	MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0105243_122595282	3300009148	Miscanthus Rhizosphere	TNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0075423_115615212	3300009162	Populus Rhizosphere	MANRLGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0105242_112548632	3300009176	Miscanthus Rhizosphere	RVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0126374_100686311	3300009792	Tropical Forest Soil	MRNAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0126374_105492652	3300009792	Tropical Forest Soil	MANRLGWEMEMSERRITQLFGLGLGAIITCTMILNAFAF*
Ga0126380_117570162	3300010043	Tropical Forest Soil	VKSGRLEMSERRITQLFGLILGALFTCTLVLNAFAF*
Ga0126384_106843853	3300010046	Tropical Forest Soil	GGTSQPQMMDMSERRITQLFGLVLGAIVTCTLVLNAFAF*
Ga0126376_102041771	3300010359	Tropical Forest Soil	MANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0126372_110041382	3300010360	Tropical Forest Soil	VGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF*
Ga0126379_103954424	3300010366	Tropical Forest Soil	SVCGYNQSQRMANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0126379_105363353	3300010366	Tropical Forest Soil	FRVLEGAMSERRITQWFGLILGAIFTFGLVLNAFAF*
Ga0126379_114631292	3300010366	Tropical Forest Soil	RLVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF*
Ga0134128_130814791	3300010373	Terrestrial Soil	PTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0126381_1026122672	3300010376	Tropical Forest Soil	KKGERDMSERKITQLFGLILGVLFACTLVLNVFAF*
Ga0126381_1033608631	3300010376	Tropical Forest Soil	RKIFRAQVGRLDMTERRITQLFGLALGAIVTCTLVLNAFAF*
Ga0126383_107470792	3300010398	Tropical Forest Soil	VVGRLDMTERRITQLFGLILGGMVTCTLVLNAFAF*
Ga0126383_135233821	3300010398	Tropical Forest Soil	MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0151489_16041341	3300011106	Soil	MLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0153974_10511661	3300012180	Attine Ant Fungus Gardens	MANHLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0137364_105798151	3300012198	Vadose Zone Soil	RPMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY*
Ga0137365_108572752	3300012201	Vadose Zone Soil	RATKVKDGRLDMSERKITQLFGLILGALFTCTLVLNAFAF*
Ga0137376_103102073	3300012208	Vadose Zone Soil	MAIRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF*
Ga0137387_108921832	3300012349	Vadose Zone Soil	MPIRLGWELEISERPITQLFGLVLGAIITCTMVLNAFAF*
Ga0137360_106188222	3300012361	Vadose Zone Soil	IARATKVKDGRLEMSERRITQWFGLILGALFTCTLVLNAFAF*
Ga0137395_101577853	3300012917	Vadose Zone Soil	MAGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0137404_120530331	3300012929	Vadose Zone Soil	RLGWEVEMTERRITQLFGLTLGAMVTCTLVLNAFAF*
Ga0137404_121427462	3300012929	Vadose Zone Soil	MEWGAIMSERQITRLFGLILGAVLTCGLILNAFAF*
Ga0164298_115998832	3300012955	Soil	MANRLGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0164301_107730142	3300012960	Soil	MANDWVGSWKMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0134076_100366044	3300012976	Grasslands Soil	FKWELDMSERKITQLFGLILGILFACTLVLNAFAF*
Ga0163163_124186951	3300014325	Switchgrass Rhizosphere	RSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0157376_131070951	3300014969	Miscanthus Rhizosphere	TNGVVRPTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0137403_105597581	3300015264	Vadose Zone Soil	MAGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF*
Ga0132258_106537781	3300015371	Arabidopsis Rhizosphere	DRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF*
Ga0132258_115431353	3300015371	Arabidopsis Rhizosphere	MANRLGWELEMSERRITQVFGLVLGAIITCTMVLNAFAF*
Ga0182039_111644062	3300016422	Soil	MRGAAAEMSERKITQLFGLILGALFTCALILNAFAS
Ga0182038_113979431	3300016445	Soil	MANRWVWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0066662_117623632	3300018468	Grasslands Soil	RMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0210381_104042851	3300021078	Groundwater Sediment	FDRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0213878_101814262	3300021444	Bulk Soil	MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0126371_124620691	3300021560	Tropical Forest Soil	MRKIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF
Ga0242658_11234571	3300022530	Soil	DWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242660_12304602	3300022531	Soil	LGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242662_103302782	3300022533	Soil	ANHLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0242654_103843681	3300022726	Soil	NDWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0207684_100238217	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0207684_101825933	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0207649_115863902	3300025920	Corn Rhizosphere	LIVRWLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0207644_100829513	3300025931	Switchgrass Rhizosphere	TNGVVRPTNHSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0207676_110142861	3300026095	Switchgrass Rhizosphere	LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0209729_10413542	3300027061	Forest Soil	MANRLGWKLKMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0209622_10918632	3300027502	Forest Soil	MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0209799_10105852	3300027654	Tropical Forest Soil	MVGTLDMSERRITQLFGLVLGAMVTCTLVLNAFAF
Ga0209180_104498302	3300027846	Vadose Zone Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF
Ga0209488_103321212	3300027903	Vadose Zone Soil	SGLFDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0209382_121179252	3300027909	Populus Rhizosphere	NLRVLEGAMSERRITQLFGLILGAIFTFGLVLNAFAF
Ga0247822_107373321	3300028592	Soil	RATNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307293_100197721	3300028711	Soil	LLDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307280_100341763	3300028768	Soil	PSGLFDRLIIWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307292_101940942	3300028811	Soil	VRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307310_104422141	3300028824	Soil	PTNGTVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307278_103790881	3300028878	Soil	IVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0307497_100768171	3300031226	Soil	FDRLIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF
Ga0318541_102684402	3300031545	Soil	MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318554_101190191	3300031765	Soil	VQQPQNLVGRLDMSERRITQLFGLVLGAMVTCTLVLNAFAF
Ga0318543_101570362	3300031777	Soil	RMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318543_102836681	3300031777	Soil	VQVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF
Ga0318552_103570391	3300031782	Soil	TQRMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF
Ga0318499_100826481	3300031832	Soil	QRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0310909_110218391	3300031947	Soil	SARCAAEISERKITQLFGLILGALFTCTLILNAFAF
Ga0318562_102602443	3300032008	Soil	VQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318575_104053512	3300032055	Soil	RLRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318533_108203491	3300032059	Soil	RVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0318524_107473362	3300032067	Soil	RMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0307470_103321481	3300032174	Hardwood Forest Soil	MAGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF
Ga0307471_1003846353	3300032180	Hardwood Forest Soil	VIKFSGQVREAEMTERRITQLFGLILGALFTGTLILNAFAF
Ga0306920_1028899992	3300032261	Soil	GNMVWRLDMTERRITQLFGLILGAIVTCTLVLNAFAF
Ga0318519_109114961	3300033290	Soil	LRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign