Metagenome Family F094791

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094791
Family Type	Metagenome
Number of Sequences	105
Average Sequence Length	42 residues
Representative Sequence	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT
Number of Associated Samples	55
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	75.24 %
% of genes from short scaffolds (< 2000 bps)	97.14 %
Associated GOLD sequencing projects	55
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (79.048 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.429 % of family members)
Environment Ontology (ENVO)	Unclassified (91.429 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (91.429 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF00078	RVT_1	0.95
PF10551	MULE	0.95
PF04434	SWIM	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG4279	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.95
COG4715	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.95
COG5431	Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain	General function prediction only [R]	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
All Organisms	root	All Organisms	20.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
cellular organisms	root	All Organisms → cellular organisms	20.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	20.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.05 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	19.05 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	19.05 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19.05 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	17.14 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	17.14 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	17.14 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	17.14 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	17.14 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	17.14 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	17.14 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	17.14 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	17.14 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	17.14 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	13.33 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	12.38 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	9.52 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.95 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	9.52 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.95 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	4.76 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	3.81 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.95 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.95 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	4.76 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	3.81 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.95 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.95 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.05 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	4.76 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	3.81 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.95 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.95 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.95 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005338\|Ga0068868_100798205	Not Available	851	Open in IMG/M
3300005614\|Ga0068856_101300102	Not Available	742	Open in IMG/M
3300005718\|Ga0068866_10678191	Not Available	704	Open in IMG/M
3300009176\|Ga0105242_10696229	Not Available	994	Open in IMG/M
3300013297\|Ga0157378_11223896	Not Available	791	Open in IMG/M
3300013297\|Ga0157378_12996758	Not Available	524	Open in IMG/M
3300013297\|Ga0157378_13301755	Not Available	501	Open in IMG/M
3300013308\|Ga0157375_11253460	Not Available	871	Open in IMG/M
3300015267\|Ga0182122_1061918	Not Available	526	Open in IMG/M
3300015268\|Ga0182154_1012489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	811	Open in IMG/M
3300015268\|Ga0182154_1042111	Not Available	590	Open in IMG/M
3300015269\|Ga0182113_1052456	Not Available	608	Open in IMG/M
3300015276\|Ga0182170_1014940	Not Available	795	Open in IMG/M
3300015276\|Ga0182170_1020848	Not Available	729	Open in IMG/M
3300015276\|Ga0182170_1051408	Not Available	568	Open in IMG/M
3300015277\|Ga0182128_1059494	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	548	Open in IMG/M
3300015279\|Ga0182174_1011817	Not Available	876	Open in IMG/M
3300015279\|Ga0182174_1066194	Not Available	545	Open in IMG/M
3300015279\|Ga0182174_1078380	Not Available	517	Open in IMG/M
3300015281\|Ga0182160_1049286	Not Available	588	Open in IMG/M
3300015283\|Ga0182156_1063168	Not Available	556	Open in IMG/M
3300015285\|Ga0182186_1028549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	685	Open in IMG/M
3300015286\|Ga0182176_1074690	Not Available	525	Open in IMG/M
3300015286\|Ga0182176_1075189	Not Available	524	Open in IMG/M
3300015288\|Ga0182173_1046428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	604	Open in IMG/M
3300015289\|Ga0182138_1077274	Not Available	526	Open in IMG/M
3300015294\|Ga0182126_1009686	Not Available	964	Open in IMG/M
3300015295\|Ga0182175_1063300	Not Available	576	Open in IMG/M
3300015296\|Ga0182157_1079528	Not Available	545	Open in IMG/M
3300015300\|Ga0182108_1012725	Not Available	936	Open in IMG/M
3300015300\|Ga0182108_1061340	Not Available	597	Open in IMG/M
3300015305\|Ga0182158_1099927	Not Available	510	Open in IMG/M
3300015308\|Ga0182142_1107459	Not Available	514	Open in IMG/M
3300015314\|Ga0182140_1040681	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	691	Open in IMG/M
3300015321\|Ga0182127_1011908	Not Available	1011	Open in IMG/M
3300015321\|Ga0182127_1091540	All Organisms → cellular organisms → Eukaryota	556	Open in IMG/M
3300015322\|Ga0182110_1080966	Not Available	577	Open in IMG/M
3300015322\|Ga0182110_1113049	Not Available	518	Open in IMG/M
3300015323\|Ga0182129_1026086	Not Available	783	Open in IMG/M
3300015341\|Ga0182187_1039723	Not Available	882	Open in IMG/M
3300015341\|Ga0182187_1049419	Not Available	820	Open in IMG/M
3300015342\|Ga0182109_1042665	Not Available	918	Open in IMG/M
3300015343\|Ga0182155_1042677	Not Available	905	Open in IMG/M
3300015343\|Ga0182155_1192680	Not Available	533	Open in IMG/M
3300015344\|Ga0182189_1211182	Not Available	518	Open in IMG/M
3300015346\|Ga0182139_1177585	Not Available	571	Open in IMG/M
3300015346\|Ga0182139_1221034	Not Available	523	Open in IMG/M
3300015347\|Ga0182177_1088794	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	743	Open in IMG/M
3300015347\|Ga0182177_1090550	Not Available	738	Open in IMG/M
3300015347\|Ga0182177_1107021	Not Available	694	Open in IMG/M
3300015347\|Ga0182177_1137072	Not Available	633	Open in IMG/M
3300015351\|Ga0182161_1066345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	865	Open in IMG/M
3300015351\|Ga0182161_1105986	Not Available	724	Open in IMG/M
3300015351\|Ga0182161_1154224	Not Available	627	Open in IMG/M
3300015351\|Ga0182161_1243577	Not Available	522	Open in IMG/M
3300015351\|Ga0182161_1250152	Not Available	516	Open in IMG/M
3300015355\|Ga0182159_1042851	Not Available	1190	Open in IMG/M
3300015355\|Ga0182159_1044788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1171	Open in IMG/M
3300015355\|Ga0182159_1189018	Not Available	658	Open in IMG/M
3300015355\|Ga0182159_1298224	Not Available	540	Open in IMG/M
3300015355\|Ga0182159_1326646	Not Available	519	Open in IMG/M
3300015361\|Ga0182145_1076892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	687	Open in IMG/M
3300015361\|Ga0182145_1161596	Not Available	535	Open in IMG/M
3300015361\|Ga0182145_1162099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	534	Open in IMG/M
3300017404\|Ga0182203_1007387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1280	Open in IMG/M
3300017404\|Ga0182203_1061989	Not Available	689	Open in IMG/M
3300017407\|Ga0182220_1044776	Not Available	644	Open in IMG/M
3300017407\|Ga0182220_1080110	Not Available	549	Open in IMG/M
3300017410\|Ga0182207_1038731	Not Available	826	Open in IMG/M
3300017410\|Ga0182207_1076713	Not Available	665	Open in IMG/M
3300017410\|Ga0182207_1147518	Not Available	535	Open in IMG/M
3300017413\|Ga0182222_1074494	Not Available	555	Open in IMG/M
3300017415\|Ga0182202_1057015	Not Available	669	Open in IMG/M
3300017417\|Ga0182230_1070368	Not Available	625	Open in IMG/M
3300017420\|Ga0182228_1083652	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	589	Open in IMG/M
3300017420\|Ga0182228_1099083	Not Available	554	Open in IMG/M
3300017425\|Ga0182224_1000180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3632	Open in IMG/M
3300017425\|Ga0182224_1020543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	954	Open in IMG/M
3300017425\|Ga0182224_1103054	Not Available	587	Open in IMG/M
3300017425\|Ga0182224_1120095	Not Available	559	Open in IMG/M
3300017425\|Ga0182224_1152898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	516	Open in IMG/M
3300017425\|Ga0182224_1164130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	503	Open in IMG/M
3300017427\|Ga0182190_1009123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1295	Open in IMG/M
3300017427\|Ga0182190_1023063	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	969	Open in IMG/M
3300017433\|Ga0182206_1022530	Not Available	923	Open in IMG/M
3300017433\|Ga0182206_1070183	Not Available	653	Open in IMG/M
3300017433\|Ga0182206_1112631	Not Available	562	Open in IMG/M
3300017436\|Ga0182209_1030316	Not Available	869	Open in IMG/M
3300017436\|Ga0182209_1060612	Not Available	704	Open in IMG/M
3300017436\|Ga0182209_1162943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	513	Open in IMG/M
3300017438\|Ga0182191_1093775	Not Available	630	Open in IMG/M
3300017438\|Ga0182191_1137704	Not Available	554	Open in IMG/M
3300017443\|Ga0182193_1004707	Not Available	1568	Open in IMG/M
3300017683\|Ga0182218_1079019	Not Available	618	Open in IMG/M
3300017683\|Ga0182218_1091259	Not Available	591	Open in IMG/M
3300017683\|Ga0182218_1093326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	587	Open in IMG/M
3300017684\|Ga0182225_1093871	Not Available	575	Open in IMG/M
3300017690\|Ga0182223_1038496	Not Available	694	Open in IMG/M
3300017690\|Ga0182223_1046337	Not Available	660	Open in IMG/M
3300017690\|Ga0182223_1070938	Not Available	588	Open in IMG/M
3300017690\|Ga0182223_1093978	Not Available	544	Open in IMG/M
3300017690\|Ga0182223_1111126	Not Available	519	Open in IMG/M
3300025960\|Ga0207651_10796260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	838	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	91.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.71%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.86%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	91.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.86%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	91.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	91.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1007982051	3300005338	Miscanthus Rhizosphere	VTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT*
Ga0068856_1013001021	3300005614	Corn Rhizosphere	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0068866_106781912	3300005718	Miscanthus Rhizosphere	MMVTAKLITILAGMEVGLKSFAISRTIGLYGLKFAKSFALTDDFLT*
Ga0105242_106962291	3300009176	Miscanthus Rhizosphere	YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVKSSALVDDFLT*
Ga0157378_112238961	3300013297	Miscanthus Rhizosphere	TILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0157378_129967581	3300013297	Miscanthus Rhizosphere	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSAMADDFLT*
Ga0157378_133017551	3300013297	Miscanthus Rhizosphere	VMVTAKLITILAGMEVGLKSFVISWTTELYGLKFAKLSALANDFLT*
Ga0157375_112534601	3300013308	Miscanthus Rhizosphere	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALADDFLT
Ga0182122_10619181	3300015267	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLLNFI*
Ga0182154_10124892	3300015268	Miscanthus Phyllosphere	AKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALADDFPT*
Ga0182154_10421111	3300015268	Miscanthus Phyllosphere	AKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSSVLADDFLT*
Ga0182113_10524561	3300015269	Miscanthus Phyllosphere	VTAKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALTDDFLT*
Ga0182170_10149401	3300015276	Miscanthus Phyllosphere	LAGMEVVLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0182170_10208481	3300015276	Miscanthus Phyllosphere	TILAGMEVGLKSFMISRTTGLYRLKFAKSSALEDDFLT*
Ga0182170_10514082	3300015276	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSALADDFLT*
Ga0182128_10594941	3300015277	Miscanthus Phyllosphere	VTAKLITIMAGTQVGLKSFAISRTTGLYGLKFAKSSALADDFLT*
Ga0182174_10118171	3300015279	Miscanthus Phyllosphere	MVTAKLITILARMEVGLKSFVISRTIGLYGLKFAKSSALAGDFLT*
Ga0182174_10661941	3300015279	Miscanthus Phyllosphere	MLTAKLITILAGMEVGLKSFVISRTTGLYGLKFDKSSALADDFLT*
Ga0182174_10783801	3300015279	Miscanthus Phyllosphere	ITIMAGTRVGLKSFVISWTTGLYGLKFTKSSALAGDFLT*
Ga0182160_10492861	3300015281	Miscanthus Phyllosphere	YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALMDDSLT*
Ga0182156_10631681	3300015283	Miscanthus Phyllosphere	TILAGMEVGLKSFVISWTNRLYGLKFAESSALTDDFLT*
Ga0182186_10285491	3300015285	Miscanthus Phyllosphere	VTVTAKLITILAGIEVGLKSFVISRTTGLYGLKFAKSSTLADDFLT*
Ga0182176_10746901	3300015286	Miscanthus Phyllosphere	YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLT*
Ga0182176_10751891	3300015286	Miscanthus Phyllosphere	LAGMEVGLKSFMISRTTGLYGLKFAQSSALADDFLT*
Ga0182173_10464281	3300015288	Miscanthus Phyllosphere	ILAGMEVGLKSFVISWTTGLYGLKFAKSSALANDFLT*
Ga0182138_10772741	3300015289	Miscanthus Phyllosphere	TIMAGTRVGLKSVVISRTTGLYGLKFVQSSALMDDSLT*
Ga0182125_10219423	3300015291	Miscanthus Phyllosphere	TILAGMEFGLKSFVISWTTGLYGLKFAKLSALADDFLT*
Ga0182126_10096861	3300015294	Miscanthus Phyllosphere	VMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALVDDFLT*
Ga0182175_10633001	3300015295	Miscanthus Phyllosphere	AAKLITIMAGTRVGLKSFVISQTTGLYGLKFVQSFALVDDSLT*
Ga0182157_10795281	3300015296	Miscanthus Phyllosphere	GTRVGLKSLAISRTSGLYGLKFAKSSALVDGFLT*
Ga0182108_10127251	3300015300	Miscanthus Phyllosphere	YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALTNDFLT*
Ga0182108_10613401	3300015300	Miscanthus Phyllosphere	TIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLT*
Ga0182158_10999271	3300015305	Miscanthus Phyllosphere	AGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT*
Ga0182142_11074591	3300015308	Miscanthus Phyllosphere	TAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALADDFLI*
Ga0182140_10406812	3300015314	Miscanthus Phyllosphere	VMVTAKLITILAGMEVGLKSFVISRTTGLYRLKFAKSSALADDFLT*
Ga0182127_10119081	3300015321	Miscanthus Phyllosphere	MVTAKLIMILAGMEVGLKSFVISWTTGLYELKFAQSSALADDFLT*
Ga0182127_10915402	3300015321	Miscanthus Phyllosphere	MVTAKLITILARMEVGLKSFMISRTTGLYGLKFAKSSALAGDFLT*
Ga0182110_10809662	3300015322	Miscanthus Phyllosphere	TIMAGTRVGLKSFVISRTTGLYGLKFAKSSALANDFLT*
Ga0182110_11130491	3300015322	Miscanthus Phyllosphere	TILAGMEVGLKSFVISRTTGLYGLKFAKSSVLADDFLT*
Ga0182129_10260863	3300015323	Miscanthus Phyllosphere	LAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0182187_10397231	3300015341	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFVISQTIGLYGLKFTKSSALADDFLI*
Ga0182187_10494192	3300015341	Miscanthus Phyllosphere	MQTFMYYVMVTAKLITILAGMEVGLKSFMISQTTGLYGLKFAKSSALADDFLT*
Ga0182109_10426651	3300015342	Miscanthus Phyllosphere	KLITIMAGTRVGLKSFAISRTTGLYGLKFARSSALVDDFLT*
Ga0182155_10426771	3300015343	Miscanthus Phyllosphere	MVTAKLIMILAGMEVGLKSFVISRTIGLYGLKFAKSSALADDFLT*
Ga0182155_11926802	3300015343	Miscanthus Phyllosphere	AGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLLNFI*
Ga0182189_12111822	3300015344	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFVISRTTGLYGLKFVKSSALADDFLT*
Ga0182139_11775851	3300015346	Miscanthus Phyllosphere	MVTAKLITILAGIEIGLKSFVILRTTGLYGLKFAKSSALADDFLT*
Ga0182139_12210341	3300015346	Miscanthus Phyllosphere	MVTAKLITILAGIEVGLKSFVISRTTGLYGLKFAKSSAPANDFLT*
Ga0182177_10887941	3300015347	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFVISWTIGLYGLKFAKLSALANDFLT*
Ga0182177_10905502	3300015347	Miscanthus Phyllosphere	VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFIQSSALVDDSLT*
Ga0182177_11070212	3300015347	Miscanthus Phyllosphere	VMVTAKLITILAGMEIGLKSFVISRTTGLYGLKFAKSFARADDFLT*
Ga0182177_11370722	3300015347	Miscanthus Phyllosphere	VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSPALMDDFLT*
Ga0182161_10663451	3300015351	Miscanthus Phyllosphere	ILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT*
Ga0182161_11059861	3300015351	Miscanthus Phyllosphere	AKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0182161_11542241	3300015351	Miscanthus Phyllosphere	AKLIMILARMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT*
Ga0182161_12435771	3300015351	Miscanthus Phyllosphere	TAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDDFLLNFV*
Ga0182161_12501521	3300015351	Miscanthus Phyllosphere	ITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0182159_10428513	3300015355	Miscanthus Phyllosphere	VLVTAKLITILAGMEVGLKSFVILRTTGLYGLKFAQSSALADDFLT*
Ga0182159_10447881	3300015355	Miscanthus Phyllosphere	TILAGMEVGLKSFVISRTTGLYGLKFAKSSALANDFLT*
Ga0182159_11890181	3300015355	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFVISRTIGLYGLKFAKSSALVDDFLT*
Ga0182159_12982241	3300015355	Miscanthus Phyllosphere	LITIMAGTRVGLKSFVISRTTGLYGLKFAKSSALAGDFLT*
Ga0182159_13266461	3300015355	Miscanthus Phyllosphere	MVTAKLITILAKMEVGLKSFVISQTIGLYGLKFTKSSALADDFLI*
Ga0182145_10768923	3300015361	Miscanthus Phyllosphere	LITILAGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLS*
Ga0182145_11615961	3300015361	Miscanthus Phyllosphere	AGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT*
Ga0182145_11620992	3300015361	Miscanthus Phyllosphere	GMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT*
Ga0182203_10073873	3300017404	Miscanthus Phyllosphere	ITIMAGTRVGLKSFVISWTTGLYGLKFVKSSTLVDDFLT
Ga0182203_10619891	3300017404	Miscanthus Phyllosphere	ILAGMEVGLKSFVISRTIGLYGLKFAQSSALADDFLT
Ga0182220_10447761	3300017407	Miscanthus Phyllosphere	MVTAKLITILAGMRVGLKSFVISRTTGLYGLKFAKSSALAGDFLT
Ga0182220_10801101	3300017407	Miscanthus Phyllosphere	LVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALVDNFLT
Ga0182207_10387311	3300017410	Miscanthus Phyllosphere	VMVTAKLITILAGMEVGLKSFVISRTIGLYGLKFAKSSALTDDFLT
Ga0182207_10767131	3300017410	Miscanthus Phyllosphere	VTAKLITILAGMEVGLKSFAISRTTGLYRLKFAKSSALADDFLT
Ga0182207_11475181	3300017410	Miscanthus Phyllosphere	TILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT
Ga0182222_10744941	3300017413	Miscanthus Phyllosphere	AKLITIMAGTRVGLKSFVISWTTGLYGLKFAKSYALADDFLT
Ga0182202_10570152	3300017415	Miscanthus Phyllosphere	VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALMDDFLT
Ga0182230_10703682	3300017417	Miscanthus Phyllosphere	VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALVDDSLT
Ga0182228_10836522	3300017420	Miscanthus Phyllosphere	ITIMAGTRVGLKSFAISRTTGLYGLKFVKSSALADDFLT
Ga0182228_10990831	3300017420	Miscanthus Phyllosphere	ANLITILAKLLCNRLKSFMISQTTGLYGLKFAKLSDLAGDSIFNFV
Ga0182224_10001801	3300017425	Miscanthus Phyllosphere	YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSAPADDFLT
Ga0182224_10205433	3300017425	Miscanthus Phyllosphere	MVTAKLITIFAGIEVGLKSFVISRTTGLYGLKLAKSSALADDFLT
Ga0182224_11030541	3300017425	Miscanthus Phyllosphere	TILAGMEVGLKSFVISRTTGLYGVKFAQSSALADDFLT
Ga0182224_11200952	3300017425	Miscanthus Phyllosphere	YVMVTAKLITILAGMEVGLKSFVISLTTGLYWLKFAKSSARADDFLT
Ga0182224_11528981	3300017425	Miscanthus Phyllosphere	AKLITILAGMEVGLKSFAISRTTGLYGLKFAKSSPLADDFLT
Ga0182224_11641302	3300017425	Miscanthus Phyllosphere	AGMEVGLKSFAISRTTGLYGLKFAKSSALADDFLT
Ga0182190_10091232	3300017427	Miscanthus Phyllosphere	VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALMDDFLT
Ga0182190_10230633	3300017427	Miscanthus Phyllosphere	AGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT
Ga0182206_10225301	3300017433	Miscanthus Phyllosphere	YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALTDDFLT
Ga0182206_10701831	3300017433	Miscanthus Phyllosphere	KLITILAGMEVGLKSFVISRTTGLYGLKFPKSSALVNDFLT
Ga0182206_11126312	3300017433	Miscanthus Phyllosphere	AKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSGLADDFLT
Ga0182209_10303161	3300017436	Miscanthus Phyllosphere	VMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVQSSALVNDSLT
Ga0182209_10606121	3300017436	Miscanthus Phyllosphere	TIMAGTRVGLKSVVISRTIGLYGLKFVKLSASVEDFLT
Ga0182209_11629431	3300017436	Miscanthus Phyllosphere	VMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALTDDFLT
Ga0182191_10937751	3300017438	Miscanthus Phyllosphere	MVTAKLITILAGMEVGLKSFMISRTTGLYGLKFAESSALADDFLT
Ga0182191_11377041	3300017438	Miscanthus Phyllosphere	MVTAKLIMILAGMEVGLTSFVISQTTGLYGLKFAKSSALADGFLT
Ga0182193_10047071	3300017443	Miscanthus Phyllosphere	AKLITILAGMEVGLKSFVISRTTGLYELKFAQSSALANDFLT
Ga0182218_10790192	3300017683	Miscanthus Phyllosphere	VTTKLITILAGMEIGLKSFVISRTTGLYGLKFAKSSARTDDFLT
Ga0182218_10912591	3300017683	Miscanthus Phyllosphere	YVMVTAKLITILAGMEVGLKSFVISRTTGLYGLKFAKSSALSDDFLT
Ga0182218_10933261	3300017683	Miscanthus Phyllosphere	AGMEVGLKSFVISRTTGLYGLKFAKSSALADDFLT
Ga0182225_10938711	3300017684	Miscanthus Phyllosphere	YVMVTTKLITILAGMEVGLKSFVISRTIGLYGLKFAQSSALADDFLT
Ga0182225_11420571	3300017684	Miscanthus Phyllosphere	ILAGMEVGLKSFVISWTTGLYGLKFAKLSALADDFLT
Ga0182223_10384961	3300017690	Miscanthus Phyllosphere	YVMVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAQSSALIDDFLT
Ga0182223_10463371	3300017690	Miscanthus Phyllosphere	ILAGMEVGLKSFVISWTTGLYGLKFAKSSALADDFLT
Ga0182223_10709382	3300017690	Miscanthus Phyllosphere	VTAKLITIMAGTRVGLKSFVISRTTGLYGLKFVKSSALVDDFLT
Ga0182223_10939782	3300017690	Miscanthus Phyllosphere	MVTAKLITIMAGTRVGLKSFVISRTTGLYGLKFAKSSALVDDFLT
Ga0182223_11111261	3300017690	Miscanthus Phyllosphere	VGMEVGLKSFVISRTTGLYGLKFAKSSALSDDFLT
Ga0207651_107962602	3300025960	Switchgrass Rhizosphere	MVAAKLITILAGMEVGLKSFVISRTTGLYGLKFAQSSALVDDFLT

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F094791

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences