Basic Information | |
---|---|
Family ID | F094818 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 43 residues |
Representative Sequence | DLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP |
Number of Associated Samples | 68 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.95 % |
% of genes near scaffold ends (potentially truncated) | 90.48 % |
% of genes from short scaffolds (< 2000 bps) | 99.05 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (86.667 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (71.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.286 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (85.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 86.67 % |
All Organisms | root | All Organisms | 13.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300009092|Ga0105250_10402109 | Not Available | 607 | Open in IMG/M |
3300009972|Ga0105137_102573 | Not Available | 764 | Open in IMG/M |
3300009972|Ga0105137_104496 | Not Available | 657 | Open in IMG/M |
3300009976|Ga0105128_108763 | Not Available | 669 | Open in IMG/M |
3300009980|Ga0105135_112306 | Not Available | 676 | Open in IMG/M |
3300009981|Ga0105133_106703 | Not Available | 787 | Open in IMG/M |
3300009981|Ga0105133_110328 | Not Available | 702 | Open in IMG/M |
3300009981|Ga0105133_113997 | Not Available | 648 | Open in IMG/M |
3300009989|Ga0105131_101795 | Not Available | 1432 | Open in IMG/M |
3300009989|Ga0105131_102096 | Not Available | 1341 | Open in IMG/M |
3300009989|Ga0105131_115510 | Not Available | 706 | Open in IMG/M |
3300009989|Ga0105131_128042 | Not Available | 590 | Open in IMG/M |
3300009990|Ga0105132_106195 | Not Available | 896 | Open in IMG/M |
3300009990|Ga0105132_114931 | Not Available | 709 | Open in IMG/M |
3300009990|Ga0105132_135434 | Not Available | 549 | Open in IMG/M |
3300009990|Ga0105132_136925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 541 | Open in IMG/M |
3300009994|Ga0105126_1005096 | Not Available | 1100 | Open in IMG/M |
3300009995|Ga0105139_1007571 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 1304 | Open in IMG/M |
3300009995|Ga0105139_1040525 | Not Available | 789 | Open in IMG/M |
3300009995|Ga0105139_1043476 | Not Available | 770 | Open in IMG/M |
3300009995|Ga0105139_1045551 | Not Available | 758 | Open in IMG/M |
3300010396|Ga0134126_12459097 | Not Available | 566 | Open in IMG/M |
3300010397|Ga0134124_10655588 | Not Available | 1034 | Open in IMG/M |
3300010399|Ga0134127_13006050 | Not Available | 550 | Open in IMG/M |
3300010400|Ga0134122_10724806 | Not Available | 938 | Open in IMG/M |
3300014968|Ga0157379_12177893 | Not Available | 550 | Open in IMG/M |
3300015273|Ga0182102_1017090 | Not Available | 658 | Open in IMG/M |
3300015278|Ga0182099_1059588 | Not Available | 536 | Open in IMG/M |
3300015280|Ga0182100_1025626 | Not Available | 786 | Open in IMG/M |
3300015280|Ga0182100_1034178 | Not Available | 721 | Open in IMG/M |
3300015280|Ga0182100_1064079 | Not Available | 588 | Open in IMG/M |
3300015284|Ga0182101_1028931 | Not Available | 756 | Open in IMG/M |
3300015284|Ga0182101_1064378 | Not Available | 587 | Open in IMG/M |
3300015284|Ga0182101_1091338 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 519 | Open in IMG/M |
3300015290|Ga0182105_1002156 | Not Available | 1608 | Open in IMG/M |
3300015293|Ga0182103_1022110 | Not Available | 811 | Open in IMG/M |
3300015293|Ga0182103_1031908 | Not Available | 731 | Open in IMG/M |
3300015297|Ga0182104_1070582 | Not Available | 611 | Open in IMG/M |
3300015297|Ga0182104_1089527 | Not Available | 562 | Open in IMG/M |
3300015306|Ga0182180_1030739 | Not Available | 753 | Open in IMG/M |
3300015306|Ga0182180_1032661 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 736 | Open in IMG/M |
3300015309|Ga0182098_1123435 | Not Available | 510 | Open in IMG/M |
3300015311|Ga0182182_1039164 | Not Available | 747 | Open in IMG/M |
3300015312|Ga0182168_1069896 | Not Available | 652 | Open in IMG/M |
3300015315|Ga0182120_1059055 | Not Available | 697 | Open in IMG/M |
3300015315|Ga0182120_1073320 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 645 | Open in IMG/M |
3300015315|Ga0182120_1076139 | Not Available | 636 | Open in IMG/M |
3300015317|Ga0182136_1008394 | Not Available | 1275 | Open in IMG/M |
3300015317|Ga0182136_1058553 | Not Available | 700 | Open in IMG/M |
3300015318|Ga0182181_1073928 | Not Available | 588 | Open in IMG/M |
3300015319|Ga0182130_1118241 | Not Available | 533 | Open in IMG/M |
3300015324|Ga0182134_1033526 | Not Available | 863 | Open in IMG/M |
3300015324|Ga0182134_1059330 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 712 | Open in IMG/M |
3300015324|Ga0182134_1137634 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 518 | Open in IMG/M |
3300015325|Ga0182148_1066685 | Not Available | 675 | Open in IMG/M |
3300015326|Ga0182166_1063975 | Not Available | 682 | Open in IMG/M |
3300015327|Ga0182114_1075344 | Not Available | 686 | Open in IMG/M |
3300015328|Ga0182153_1013331 | Not Available | 1148 | Open in IMG/M |
3300015328|Ga0182153_1065200 | Not Available | 695 | Open in IMG/M |
3300015329|Ga0182135_1114822 | Not Available | 568 | Open in IMG/M |
3300015330|Ga0182152_1073274 | Not Available | 674 | Open in IMG/M |
3300015331|Ga0182131_1087788 | Not Available | 633 | Open in IMG/M |
3300015332|Ga0182117_1076063 | Not Available | 704 | Open in IMG/M |
3300015333|Ga0182147_1103285 | Not Available | 617 | Open in IMG/M |
3300015334|Ga0182132_1086953 | Not Available | 663 | Open in IMG/M |
3300015335|Ga0182116_1114333 | Not Available | 613 | Open in IMG/M |
3300015336|Ga0182150_1090619 | Not Available | 642 | Open in IMG/M |
3300015337|Ga0182151_1039652 | Not Available | 860 | Open in IMG/M |
3300015337|Ga0182151_1044840 | Not Available | 826 | Open in IMG/M |
3300015337|Ga0182151_1152042 | Not Available | 522 | Open in IMG/M |
3300015338|Ga0182137_1031683 | Not Available | 987 | Open in IMG/M |
3300015338|Ga0182137_1169012 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 515 | Open in IMG/M |
3300015338|Ga0182137_1179530 | Not Available | 501 | Open in IMG/M |
3300015339|Ga0182149_1113402 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 602 | Open in IMG/M |
3300015340|Ga0182133_1036733 | Not Available | 962 | Open in IMG/M |
3300015350|Ga0182163_1189537 | Not Available | 644 | Open in IMG/M |
3300015350|Ga0182163_1295398 | Not Available | 507 | Open in IMG/M |
3300015352|Ga0182169_1268980 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 552 | Open in IMG/M |
3300015352|Ga0182169_1296431 | Not Available | 522 | Open in IMG/M |
3300015354|Ga0182167_1223456 | Not Available | 685 | Open in IMG/M |
3300015354|Ga0182167_1251890 | Not Available | 636 | Open in IMG/M |
3300017408|Ga0182197_1059260 | Not Available | 719 | Open in IMG/M |
3300017408|Ga0182197_1133354 | Not Available | 528 | Open in IMG/M |
3300017414|Ga0182195_1099453 | Not Available | 692 | Open in IMG/M |
3300017421|Ga0182213_1079406 | Not Available | 905 | Open in IMG/M |
3300017445|Ga0182198_1099884 | Not Available | 662 | Open in IMG/M |
3300017445|Ga0182198_1109422 | Not Available | 640 | Open in IMG/M |
3300017447|Ga0182215_1082818 | Not Available | 704 | Open in IMG/M |
3300017447|Ga0182215_1111012 | Not Available | 616 | Open in IMG/M |
3300017693|Ga0182216_1188596 | Not Available | 539 | Open in IMG/M |
3300017693|Ga0182216_1226724 | Not Available | 500 | Open in IMG/M |
3300017694|Ga0182211_1113510 | Not Available | 637 | Open in IMG/M |
3300028049|Ga0268322_1042336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 558 | Open in IMG/M |
3300028050|Ga0268328_1008011 | Not Available | 1028 | Open in IMG/M |
3300028056|Ga0268330_1042168 | Not Available | 582 | Open in IMG/M |
3300028152|Ga0268336_1012672 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 662 | Open in IMG/M |
3300032464|Ga0214492_1000247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 4441 | Open in IMG/M |
3300032464|Ga0214492_1084139 | Not Available | 603 | Open in IMG/M |
3300032467|Ga0214488_1092672 | Not Available | 659 | Open in IMG/M |
3300032590|Ga0214489_1072125 | Not Available | 507 | Open in IMG/M |
3300032625|Ga0214501_1274697 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 533 | Open in IMG/M |
3300032792|Ga0314744_1073719 | Not Available | 658 | Open in IMG/M |
3300032824|Ga0314735_1064863 | Not Available | 690 | Open in IMG/M |
3300033533|Ga0314770_1294101 | Not Available | 508 | Open in IMG/M |
3300033535|Ga0314759_1041081 | Not Available | 1352 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 71.43% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 19.05% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 3.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0105250_104021092 | 3300009092 | Switchgrass Rhizosphere | CHGLLPYEYHHLESVDESGTQVWSELSLADEYVLSDVTAAVAPPEPEDP* |
Ga0105137_1025731 | 3300009972 | Switchgrass Associated | PCEYHHLESVDESGTQVWSELSLADEYALSDVTAAVAPPRPEDP* |
Ga0105137_1044962 | 3300009972 | Switchgrass Associated | AVHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTTAVAPPEPEDL* |
Ga0105128_1087631 | 3300009976 | Switchgrass Associated | AAAVHDLLPSVCHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0105135_1123061 | 3300009980 | Switchgrass Associated | VVVSGTQVWSELSLADEHILSDVTAAVAPPEPEDP* |
Ga0105133_1067032 | 3300009981 | Switchgrass Associated | VDESGTQVWSVMSLASEYVLNDVTAAVAPPESEDP* |
Ga0105133_1103281 | 3300009981 | Switchgrass Associated | HHLESEDESGTQVWSELSEYVLSDVTAAVAPPEPEDP* |
Ga0105133_1139971 | 3300009981 | Switchgrass Associated | LESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESTDL* |
Ga0105131_1017951 | 3300009989 | Switchgrass Associated | LLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0105131_1020961 | 3300009989 | Switchgrass Associated | VHDLLPSEYHYLESVDESGTQVWSELSEYVLSDVTAAVAPPEPEDL* |
Ga0105131_1155102 | 3300009989 | Switchgrass Associated | HHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL* |
Ga0105131_1280421 | 3300009989 | Switchgrass Associated | SECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP* |
Ga0105132_1061952 | 3300009990 | Switchgrass Associated | PSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL* |
Ga0105132_1149312 | 3300009990 | Switchgrass Associated | LPSEYHHLESMDESGTQVRSELSEYVLSDVTADVAPPEPEDL* |
Ga0105132_1354341 | 3300009990 | Switchgrass Associated | VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPPEPEDP* |
Ga0105132_1369251 | 3300009990 | Switchgrass Associated | VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEA |
Ga0105126_10050963 | 3300009994 | Switchgrass Associated | VHDLLPSEYHHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP* |
Ga0105139_10075712 | 3300009995 | Switchgrass Associated | VHGLLPSEYHHLESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEDP* |
Ga0105139_10405251 | 3300009995 | Switchgrass Associated | HCHGLLPCEYHHLESVDESGTQVWSKLALADEYVLSDVTAVVAHHEPEDP* |
Ga0105139_10434762 | 3300009995 | Switchgrass Associated | HLESVDVSGTQVWSELSEYVLSDVTAAMAPPEPEDL* |
Ga0105139_10455512 | 3300009995 | Switchgrass Associated | AAVHDLLPSEYHHLESVDVSRTQVWSELSEYILSDVTAVVAPPEPEDL* |
Ga0134126_124590972 | 3300010396 | Terrestrial Soil | RCAAVHGLLPSECHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL* |
Ga0134124_106555881 | 3300010397 | Terrestrial Soil | CHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0134127_130060501 | 3300010399 | Terrestrial Soil | ESVDVSGTQVWPELSEYVLSDVTAGVAPPEPKDP* |
Ga0134122_107248061 | 3300010400 | Terrestrial Soil | GLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP* |
Ga0157379_121778931 | 3300014968 | Switchgrass Rhizosphere | HHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL* |
Ga0182102_10170901 | 3300015273 | Switchgrass Phyllosphere | WHHLESVDESGTQVWYELSLAVEYALSDVTAAVAPPEPEDP* |
Ga0182099_10595882 | 3300015278 | Switchgrass Phyllosphere | LPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0182100_10256262 | 3300015280 | Switchgrass Phyllosphere | LPSECHHLESVDESGTQVWPELSEYVLSDVTAAVAPPEPEAP* |
Ga0182100_10341783 | 3300015280 | Switchgrass Phyllosphere | SECHHLESVDVSGTQVRSELSEYVLSDETAAVAPHEPEDP* |
Ga0182100_10640791 | 3300015280 | Switchgrass Phyllosphere | VPLSEYPHLESVDESGTGVWSVQPLADEYALSDVTAAPPEPEDP* |
Ga0182101_10289313 | 3300015284 | Switchgrass Phyllosphere | VDESGTQVWSVPSLADEYVLNDVTAVVAPPESEDP* |
Ga0182101_10643782 | 3300015284 | Switchgrass Phyllosphere | VHDLLPSEYYHLESVDEYGTQVRSMPSEYVLIDVTAAVAPPEPEDP* |
Ga0182101_10913381 | 3300015284 | Switchgrass Phyllosphere | VHGLLPSEYHHLESVDESGTQVWSVPSLDDEYVLNDVTAAVAPPE |
Ga0182105_10021563 | 3300015290 | Switchgrass Phyllosphere | ESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP* |
Ga0182103_10221103 | 3300015293 | Switchgrass Phyllosphere | CAAAVHDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPLEPEDP* |
Ga0182103_10319081 | 3300015293 | Switchgrass Phyllosphere | ESMDASGTQVWSELSEYVLSDVTAAVAPPEPEDP* |
Ga0182104_10705822 | 3300015297 | Switchgrass Phyllosphere | ESVDESGTQVWSELSLADEYVLGDVTAAVAPPEPEDP* |
Ga0182104_10895272 | 3300015297 | Switchgrass Phyllosphere | VHALLSVDESGTQVWSELSEYVLSDVTAAVAPPESEDP* |
Ga0182180_10307391 | 3300015306 | Switchgrass Phyllosphere | LESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEGP* |
Ga0182180_10326611 | 3300015306 | Switchgrass Phyllosphere | VHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPE |
Ga0182098_11234351 | 3300015309 | Switchgrass Phyllosphere | LLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL* |
Ga0182182_10391642 | 3300015311 | Switchgrass Phyllosphere | VHDLLPSEYYHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP* |
Ga0182168_10698961 | 3300015312 | Switchgrass Phyllosphere | ECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPGAL* |
Ga0182120_10590551 | 3300015315 | Switchgrass Phyllosphere | VHDLLLSEYYHLESVDEYGTQVRSVLSKYVLSDVTAAVAPPESEDL* |
Ga0182120_10733201 | 3300015315 | Switchgrass Phyllosphere | VHGLLLSEYHHLESVDESGTQAWSVPSLADEYVLNDVTAAVA |
Ga0182120_10761391 | 3300015315 | Switchgrass Phyllosphere | DLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP* |
Ga0182136_10083941 | 3300015317 | Switchgrass Phyllosphere | ECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPELEAP* |
Ga0182136_10585532 | 3300015317 | Switchgrass Phyllosphere | HDLLPSVCHHLESMDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0182181_10739282 | 3300015318 | Switchgrass Phyllosphere | HDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEDP* |
Ga0182130_11182411 | 3300015319 | Switchgrass Phyllosphere | AVHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL* |
Ga0182134_10335262 | 3300015324 | Switchgrass Phyllosphere | EFHHLESVDESGTQAWRSELSLADEYVLSDVTATVAPPEPEDPRS* |
Ga0182134_10593301 | 3300015324 | Switchgrass Phyllosphere | VHDLLPSEYYHLEFVDESGTQVRSVLSEYVLSDVTAAVAPPEPEDP* |
Ga0182134_11376341 | 3300015324 | Switchgrass Phyllosphere | VHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAA |
Ga0182148_10666851 | 3300015325 | Switchgrass Phyllosphere | RCAAAVHDLLPSECHHLESVDVSGTQVWPELSEYIPSDVTAAVAPPEPEDP* |
Ga0182166_10639752 | 3300015326 | Switchgrass Phyllosphere | LPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAP* |
Ga0182114_10753442 | 3300015327 | Switchgrass Phyllosphere | CAAAVHDLLPSEYHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL* |
Ga0182153_10133311 | 3300015328 | Switchgrass Phyllosphere | CAAAAVHDLLPSEYYHLESVDEYGTQVRSVLSEYILSDVTAAVAPPESEDL* |
Ga0182153_10652001 | 3300015328 | Switchgrass Phyllosphere | HHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP* |
Ga0182135_11148221 | 3300015329 | Switchgrass Phyllosphere | AAAVSDLLPSEYHHLESVDESGTQVWSELSEYVLSDVTAAVAPPESEDP* |
Ga0182152_10732741 | 3300015330 | Switchgrass Phyllosphere | SEYHHLESVDESGTQEWSVPSLADEYVLNDVTAAVAPPESEDP* |
Ga0182131_10877881 | 3300015331 | Switchgrass Phyllosphere | LESVDVSGTQVWSELSEYVRSDITAAVAPPEPEDP* |
Ga0182117_10760631 | 3300015332 | Switchgrass Phyllosphere | HCHSLVPCEYHHLESEDKSGTQVWSELSLAGEYALSDITAAVAHPEPEDP* |
Ga0182147_11032852 | 3300015333 | Switchgrass Phyllosphere | CHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPEPEDP* |
Ga0182132_10869531 | 3300015334 | Switchgrass Phyllosphere | LESVDVSGTQVWPELSEYVLSDVTAVVAPPKPEDL* |
Ga0182116_11143332 | 3300015335 | Switchgrass Phyllosphere | ESVDESGTQVWSELSLADEYVLSDVTATVAPPEPEDP* |
Ga0182150_10906192 | 3300015336 | Switchgrass Phyllosphere | YHHLESVDETGTQVWSELSLADEYALSDVTAAVAPPEPEDP* |
Ga0182151_10396521 | 3300015337 | Switchgrass Phyllosphere | LPCEYHHLESVDVSGTQVWSELSEYVLSDVTANVAPPEPEDL* |
Ga0182151_10448401 | 3300015337 | Switchgrass Phyllosphere | AAVHDLLPSEYHHLESVDESGTQVWSVLSLADEYVLNDVTAAVAPPESEDP* |
Ga0182151_11520421 | 3300015337 | Switchgrass Phyllosphere | AAAVPDLLPSEYHHLESLDVSGTQVWSELSEYVLSDVTAAVAPPEPEDL* |
Ga0182137_10316831 | 3300015338 | Switchgrass Phyllosphere | ECHHLESVDVSGTQVWPELPEYVLSDVTAAVAPPEPEDP* |
Ga0182137_11690122 | 3300015338 | Switchgrass Phyllosphere | VHDLLPSEYHHLESVDETGTQVWSELSLADEYALSDVT |
Ga0182137_11795302 | 3300015338 | Switchgrass Phyllosphere | EFVDEYGTQVRSVLSEYVLSDVTAAVAPPEPKDP* |
Ga0182149_11134022 | 3300015339 | Switchgrass Phyllosphere | VYDLLPSEYYHLESVDEYGAQVRSVLSEYVVSDVTAAVAPP |
Ga0182133_10367332 | 3300015340 | Switchgrass Phyllosphere | LLPCEYYHLESVDEYGTQVRSVLSEYVLSDVTAAVAPPEPEDP* |
Ga0182163_11895371 | 3300015350 | Switchgrass Phyllosphere | LESVDESGTQVWSELSLADEYALSDVTAVVAPPEPEDP* |
Ga0182163_12953981 | 3300015350 | Switchgrass Phyllosphere | HHLESVDESGTQVWSELSEYVLSDVTAAVAPPEPEDP* |
Ga0182169_12689801 | 3300015352 | Switchgrass Phyllosphere | VDESGTQVWPELSLADEYVLSDVTAAVAPPKPEDPSSEAN |
Ga0182169_12964311 | 3300015352 | Switchgrass Phyllosphere | VHDLLPSEYYHLESVDESGTQVRSVLSEYVLSDVIVAVAPPEPEDP* |
Ga0182167_12234561 | 3300015354 | Switchgrass Phyllosphere | YHHLESVDVSGTQVWSELSEYVLSDVTAAVAPSESEDL* |
Ga0182167_12518901 | 3300015354 | Switchgrass Phyllosphere | VHDLLPSEYHHLESVDESETQVRSELSEYVLSDVTAAVAPPVPEDL* |
Ga0182197_10592603 | 3300017408 | Switchgrass Phyllosphere | HDRLPSECHHLESVDVSGTQVLSELSEYVLSNVTTAVAPPESEDP |
Ga0182197_11333541 | 3300017408 | Switchgrass Phyllosphere | CAAAAVHGLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAVVAPPEPEDP |
Ga0182195_10994531 | 3300017414 | Switchgrass Phyllosphere | HGLLPCEYHHLESVVQSGTEVRSELSLADAYALSDVTAAVAPPEPEDP |
Ga0182213_10794061 | 3300017421 | Switchgrass Phyllosphere | WCAAAVHDLLPSKCHHLESVDVSGTQVWSELSEYVLSDVTAAVAPPESEDP |
Ga0182198_10998841 | 3300017445 | Switchgrass Phyllosphere | AAAVHDLLPSEYHHLESVDESGTQVWSVLSLANEYVLNDVTAAMAPPESEDP |
Ga0182198_11094221 | 3300017445 | Switchgrass Phyllosphere | PSEYPHLESVDESGTQVWSELSLADGYVLSYVTAVVAPHEPEDP |
Ga0182215_10828181 | 3300017447 | Switchgrass Phyllosphere | HHLESVDESGTQVWSELSLADEYVLSNVTAAVAPPEPEDP |
Ga0182215_11110121 | 3300017447 | Switchgrass Phyllosphere | LESVDESGTQVWSELSEYVLSDITAAVAPPEPEDL |
Ga0182216_11885961 | 3300017693 | Switchgrass Phyllosphere | PSDLLPSEYPHLESVDESGTQVWSELSEYVLSEVTAAVAPPKPEDL |
Ga0182216_12267241 | 3300017693 | Switchgrass Phyllosphere | LESVDVSGTPVWYELSLSDENVLSDIAAAVAPPEPEDP |
Ga0182211_11135102 | 3300017694 | Switchgrass Phyllosphere | DLLPSEYYHLESVDEYRTQVRSVLSKYVLSDVTAAVAPPELEDP |
Ga0268322_10423361 | 3300028049 | Phyllosphere | VHDLLPCRYHHLESVDESGTQVWSVLSLADEYVLNNVTTAVAPPES |
Ga0268328_10080112 | 3300028050 | Phyllosphere | HLESVDVSGTQEWPELSEYVLSDVTAAVAPPEPEAL |
Ga0268330_10421682 | 3300028056 | Phyllosphere | HLESVDESGTQVWSVPSLADEYILNDVTAAVAPPESEDP |
Ga0268336_10126721 | 3300028152 | Phyllosphere | MLPCEYHHLESVDESGTQVWSELSLANEYVLNDVTAAV |
Ga0214492_10002473 | 3300032464 | Switchgrass Phyllosphere | MHDLLPSEYHLLESVDENGTQVWSVLSLTDAYVLNDVTATVAPPEPEDL |
Ga0214492_10841392 | 3300032464 | Switchgrass Phyllosphere | HHLESVDVSGTQVWPEPSEYVLSDVPAAMAPPEPEDP |
Ga0214488_10926722 | 3300032467 | Switchgrass Phyllosphere | SECHHLESVDVSGTRVWPELSEYVLSDVTAAVAPPEPEDP |
Ga0214489_10721251 | 3300032590 | Switchgrass Phyllosphere | AAAVHDLLPSEYYHLESVDESRTQVWSVLSLADEYVLNDVTAAVAPPESQDP |
Ga0214501_12746972 | 3300032625 | Switchgrass Phyllosphere | VHDLFPFECHHLESVDESGTQVWPELSEYVLSDVTAAVA |
Ga0314744_10737191 | 3300032792 | Switchgrass Phyllosphere | CDAAVHDLLPSECHHLESVDVSGTQVWPELSEYVPSDVTAAVAPPVPEDP |
Ga0314735_10648632 | 3300032824 | Switchgrass Phyllosphere | CAAAVHDLLPSECHHLESVDVSGTQVWSELSEYVLSDVTAAVAP |
Ga0314770_12941011 | 3300033533 | Switchgrass Phyllosphere | VHDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAV |
Ga0314759_10410812 | 3300033535 | Switchgrass Phyllosphere | HDLLPSECHHLESVDVSGTQVWPELSEYVLSDVTAAVAPPEPEAL |
⦗Top⦘ |