Basic Information | |
---|---|
Family ID | F094911 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 42 residues |
Representative Sequence | MPEFFEKSPLSGAGKHPDFQVTSCHHFVTTNVDFAYIESE |
Number of Associated Samples | 35 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 26.47 % |
% of genes near scaffold ends (potentially truncated) | 59.05 % |
% of genes from short scaffolds (< 2000 bps) | 67.62 % |
Associated GOLD sequencing projects | 30 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.905 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (37.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (42.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF13385 | Laminin_G_3 | 8.57 |
PF07676 | PD40 | 4.76 |
PF01408 | GFO_IDH_MocA | 2.86 |
PF07900 | DUF1670 | 1.90 |
PF04542 | Sigma70_r2 | 1.90 |
PF13360 | PQQ_2 | 1.90 |
PF02517 | Rce1-like | 1.90 |
PF00932 | LTD | 1.90 |
PF13495 | Phage_int_SAM_4 | 1.90 |
PF12228 | DUF3604 | 0.95 |
PF00583 | Acetyltransf_1 | 0.95 |
PF13472 | Lipase_GDSL_2 | 0.95 |
PF12796 | Ank_2 | 0.95 |
PF07944 | Glyco_hydro_127 | 0.95 |
PF01229 | Glyco_hydro_39 | 0.95 |
PF03150 | CCP_MauG | 0.95 |
PF16347 | DUF4976 | 0.95 |
PF03629 | SASA | 0.95 |
PF00589 | Phage_integrase | 0.95 |
PF13393 | tRNA-synt_His | 0.95 |
PF00005 | ABC_tran | 0.95 |
PF13517 | FG-GAP_3 | 0.95 |
PF01381 | HTH_3 | 0.95 |
PF00004 | AAA | 0.95 |
PF03965 | Penicillinase_R | 0.95 |
PF04015 | DUF362 | 0.95 |
PF13633 | Obsolete Pfam Family | 0.95 |
PF14871 | GHL6 | 0.95 |
PF03577 | Peptidase_C69 | 0.95 |
PF13751 | DDE_Tnp_1_6 | 0.95 |
PF14683 | CBM-like | 0.95 |
PF01610 | DDE_Tnp_ISL3 | 0.95 |
PF14592 | Chondroitinas_B | 0.95 |
PF13649 | Methyltransf_25 | 0.95 |
PF06739 | SBBP | 0.95 |
PF02012 | BNR | 0.95 |
PF13669 | Glyoxalase_4 | 0.95 |
PF00884 | Sulfatase | 0.95 |
PF07963 | N_methyl | 0.95 |
PF02018 | CBM_4_9 | 0.95 |
PF00474 | SSF | 0.95 |
PF06283 | ThuA | 0.95 |
PF03793 | PASTA | 0.95 |
PF03786 | UxuA | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.90 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.90 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.90 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.90 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.90 |
COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 0.95 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.95 |
COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.95 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.95 |
COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.95 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.95 |
COG4690 | Dipeptidase | Amino acid transport and metabolism [E] | 0.95 |
COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.86 % |
Unclassified | root | N/A | 37.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001751|JGI2172J19969_10062065 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1185 | Open in IMG/M |
3300001751|JGI2172J19969_10117329 | Not Available | 764 | Open in IMG/M |
3300001751|JGI2172J19969_10177220 | Not Available | 589 | Open in IMG/M |
3300001752|JGI2173J19968_10069061 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300001752|JGI2173J19968_10194952 | Not Available | 563 | Open in IMG/M |
3300001753|JGI2171J19970_10016471 | All Organisms → cellular organisms → Bacteria | 3333 | Open in IMG/M |
3300001753|JGI2171J19970_10305297 | Not Available | 502 | Open in IMG/M |
3300001854|JGI24422J19971_10099771 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300001854|JGI24422J19971_10165085 | Not Available | 1013 | Open in IMG/M |
3300001854|JGI24422J19971_10374614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 548 | Open in IMG/M |
3300001854|JGI24422J19971_10383447 | Not Available | 539 | Open in IMG/M |
3300003455|KH04A_1278928 | Not Available | 526 | Open in IMG/M |
3300005612|Ga0070723_10312003 | Not Available | 745 | Open in IMG/M |
3300005821|Ga0078746_1004561 | All Organisms → cellular organisms → Bacteria | 2782 | Open in IMG/M |
3300005832|Ga0074469_10022913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4 | 710 | Open in IMG/M |
3300005832|Ga0074469_10663312 | Not Available | 748 | Open in IMG/M |
3300005920|Ga0070725_10506281 | Not Available | 544 | Open in IMG/M |
3300007871|Ga0111032_1053313 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 2090 | Open in IMG/M |
3300009034|Ga0115863_1029925 | All Organisms → cellular organisms → Bacteria | 7256 | Open in IMG/M |
3300009034|Ga0115863_1034118 | All Organisms → cellular organisms → Bacteria | 6726 | Open in IMG/M |
3300009034|Ga0115863_1074193 | All Organisms → cellular organisms → Bacteria | 4291 | Open in IMG/M |
3300009034|Ga0115863_1083692 | All Organisms → cellular organisms → Bacteria | 4011 | Open in IMG/M |
3300009034|Ga0115863_1089258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 3864 | Open in IMG/M |
3300009034|Ga0115863_1178016 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Lentisphaerales → Lentisphaeraceae → Lentisphaera → Lentisphaera araneosa → Lentisphaera araneosa HTCC2155 | 2579 | Open in IMG/M |
3300009034|Ga0115863_1199983 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_44_8b | 2408 | Open in IMG/M |
3300009034|Ga0115863_1305531 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300009034|Ga0115863_1380040 | All Organisms → cellular organisms → Bacteria → PVC group | 1642 | Open in IMG/M |
3300009034|Ga0115863_1621803 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1220 | Open in IMG/M |
3300009135|Ga0118736_10106161 | Not Available | 782 | Open in IMG/M |
3300009135|Ga0118736_10129761 | Not Available | 725 | Open in IMG/M |
3300009135|Ga0118736_10146292 | Not Available | 693 | Open in IMG/M |
3300009150|Ga0114921_10049500 | Not Available | 2622 | Open in IMG/M |
3300009150|Ga0114921_10097617 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300009150|Ga0114921_10110831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1836 | Open in IMG/M |
3300009150|Ga0114921_10126118 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1732 | Open in IMG/M |
3300009150|Ga0114921_10127016 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300009150|Ga0114921_10241378 | Not Available | 1274 | Open in IMG/M |
3300009150|Ga0114921_10304978 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1136 | Open in IMG/M |
3300009150|Ga0114921_10419172 | Not Available | 971 | Open in IMG/M |
3300009150|Ga0114921_10508877 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 880 | Open in IMG/M |
3300009150|Ga0114921_10558863 | Not Available | 839 | Open in IMG/M |
3300009150|Ga0114921_10569054 | Not Available | 832 | Open in IMG/M |
3300009150|Ga0114921_10626823 | Not Available | 791 | Open in IMG/M |
3300009150|Ga0114921_10655434 | All Organisms → cellular organisms → Archaea | 774 | Open in IMG/M |
3300009150|Ga0114921_10685400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium DG_26 | 756 | Open in IMG/M |
3300009150|Ga0114921_10689622 | Not Available | 754 | Open in IMG/M |
3300009150|Ga0114921_10792794 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 702 | Open in IMG/M |
3300009150|Ga0114921_10855405 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 675 | Open in IMG/M |
3300009150|Ga0114921_11183751 | Not Available | 572 | Open in IMG/M |
3300009488|Ga0114925_10022474 | Not Available | 3616 | Open in IMG/M |
3300009488|Ga0114925_10372042 | Not Available | 983 | Open in IMG/M |
3300009488|Ga0114925_10676125 | Not Available | 735 | Open in IMG/M |
3300009488|Ga0114925_11410453 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009499|Ga0114930_10002286 | All Organisms → cellular organisms → Bacteria | 17343 | Open in IMG/M |
3300009528|Ga0114920_10060945 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2315 | Open in IMG/M |
3300009528|Ga0114920_10132749 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300009528|Ga0114920_10902441 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300010430|Ga0118733_100257632 | All Organisms → cellular organisms → Bacteria | 3450 | Open in IMG/M |
3300010430|Ga0118733_101051969 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 1625 | Open in IMG/M |
3300010430|Ga0118733_101096703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 1589 | Open in IMG/M |
3300010430|Ga0118733_103082360 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 912 | Open in IMG/M |
3300010430|Ga0118733_108609627 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 527 | Open in IMG/M |
3300010430|Ga0118733_109537850 | Not Available | 500 | Open in IMG/M |
3300014903|Ga0164321_10008239 | All Organisms → cellular organisms → Bacteria → PVC group | 3020 | Open in IMG/M |
3300014903|Ga0164321_10025044 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2046 | Open in IMG/M |
3300014903|Ga0164321_10028000 | Not Available | 1964 | Open in IMG/M |
3300014903|Ga0164321_10110232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halobacteroidaceae → Orenia → Orenia metallireducens | 1162 | Open in IMG/M |
3300014903|Ga0164321_10477732 | Not Available | 625 | Open in IMG/M |
3300014903|Ga0164321_10703684 | Not Available | 528 | Open in IMG/M |
3300022221|Ga0224506_10483030 | Not Available | 539 | Open in IMG/M |
3300024263|Ga0209978_10009348 | All Organisms → cellular organisms → Bacteria | 4642 | Open in IMG/M |
3300024263|Ga0209978_10029078 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
3300024263|Ga0209978_10031798 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
3300024263|Ga0209978_10096994 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300024263|Ga0209978_10173315 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1101 | Open in IMG/M |
3300024263|Ga0209978_10396359 | Not Available | 674 | Open in IMG/M |
3300024263|Ga0209978_10489836 | Not Available | 588 | Open in IMG/M |
3300024263|Ga0209978_10543484 | Not Available | 549 | Open in IMG/M |
3300024353|Ga0209979_1005804 | All Organisms → cellular organisms → Bacteria | 9582 | Open in IMG/M |
3300024432|Ga0209977_10012076 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 4071 | Open in IMG/M |
3300024432|Ga0209977_10078629 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4 | 1613 | Open in IMG/M |
3300024432|Ga0209977_10553712 | Not Available | 530 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10228442 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
(restricted) 3300027865|Ga0255052_10555778 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 563 | Open in IMG/M |
3300027888|Ga0209635_10066871 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2935 | Open in IMG/M |
3300027888|Ga0209635_10077652 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae | 2715 | Open in IMG/M |
3300027888|Ga0209635_10272654 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300027888|Ga0209635_10567676 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300027901|Ga0209427_10198186 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1682 | Open in IMG/M |
3300027901|Ga0209427_10491549 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 927 | Open in IMG/M |
3300027901|Ga0209427_10532343 | Not Available | 879 | Open in IMG/M |
3300027917|Ga0209536_102156353 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 665 | Open in IMG/M |
3300031351|Ga0307427_1020524 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
3300031356|Ga0307439_1011638 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
3300031539|Ga0307380_10011606 | All Organisms → cellular organisms → Bacteria | 11018 | Open in IMG/M |
3300031539|Ga0307380_10017033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 8805 | Open in IMG/M |
3300031539|Ga0307380_10050100 | All Organisms → cellular organisms → Bacteria | 4608 | Open in IMG/M |
3300031551|Ga0315548_1052982 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
3300031551|Ga0315548_1260488 | Not Available | 512 | Open in IMG/M |
3300031565|Ga0307379_10072039 | All Organisms → cellular organisms → Bacteria | 3853 | Open in IMG/M |
3300031650|Ga0315539_1010764 | All Organisms → cellular organisms → Bacteria | 5508 | Open in IMG/M |
3300033429|Ga0316193_11515922 | Not Available | 532 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 37.14% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 18.10% |
Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 10.48% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 9.52% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 5.71% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.81% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.86% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 2.86% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.90% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.90% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.90% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.95% |
Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.95% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.95% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300001753 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-24_28 | Environmental | Open in IMG/M |
3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
3300003455 | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S16-KH04A | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
3300007871 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2 | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300031351 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-190 | Environmental | Open in IMG/M |
3300031356 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031551 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031650 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150 | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI2172J19969_100620651 | 3300001751 | Marine Sediment | SCKTSEFFEMSPLSGAGKHPDFQVTLCLHFVTTDVDFAYIESE* |
JGI2172J19969_101173291 | 3300001751 | Marine Sediment | MIEFFEKSPLSGAGKRPDFQVTSCHRFDTTNVNFAYVESE* |
JGI2172J19969_101772202 | 3300001751 | Marine Sediment | MPEFFEKSPLSGAEKQPDFQVTSCHHFVTTNVDFAYIEFE* |
JGI2173J19968_100690611 | 3300001752 | Marine Sediment | MPEFFKKAPLSEAKKHPDFQVTQCFHFVTTNANFAYVQSE* |
JGI2173J19968_101949521 | 3300001752 | Marine Sediment | MPEFFEKSPLSEAEKHPDFQVTSCLRFVTTNVDFAYTESE* |
JGI2171J19970_100164712 | 3300001753 | Marine Sediment | MPEFYEKSLLSGAGKQPDFQVTFYHHFVTTNIKFAYIESE* |
JGI2171J19970_103052972 | 3300001753 | Marine Sediment | MSESFEKSPFSGTGKHPDFHVTSCHHFVFTNVNFAYIKSE* |
JGI24422J19971_100997713 | 3300001854 | Marine Sediment | MNGKTPEFFKKPPLPGAEKHPDFQVTSCHQNVSTSVDFVYIESE* |
JGI24422J19971_101650851 | 3300001854 | Marine Sediment | MSPLSGAGKHPDFQVTLCRQNVYKNVDFAYIESE* |
JGI24422J19971_103746142 | 3300001854 | Marine Sediment | LFFLSCKIPEFFEKLPLSGAGKHPDFQVTLCLQNVTTDVDFAYIESE* |
JGI24422J19971_103834472 | 3300001854 | Marine Sediment | MSESFEKSPFSGTGKHPDFHVTSCHHFVFTNVNFAYIKFE* |
KH04A_12789281 | 3300003455 | Marine Sediment | CKTSEFFEKSPLSAAKKHPDFQVTSCHHFDTTNINFAYIESE* |
Ga0070723_103120031 | 3300005612 | Marine Sediment | MPEFFEKSPLSGAEKHHNFQVTSCHHFVTTNINFAYI |
Ga0078746_10045614 | 3300005821 | Marine Sediment | MSCKISELFEKSPLSGAEKHHNFQVTSYIHFDTTNVDFAYIESE* |
Ga0074469_100229131 | 3300005832 | Sediment (Intertidal) | KDLVFMTHKTPEIFEKSPLSGAGKHPDFQVTLCHHFDTTNTDFAYIESE* |
Ga0074469_106633121 | 3300005832 | Sediment (Intertidal) | TIKISEYFEKSPISGVEKHVNFHVTSCHQNDTTNTNFAYTGSE* |
Ga0070725_105062812 | 3300005920 | Marine Sediment | MSESFEMPPLSEAEKHPDFQVTSCHHFVTTNVDFAYI |
Ga0111032_10533133 | 3300007871 | Marine Sediment | MALNGGKPPLSGAEKHPDFQVTSCLRFVTTNVDFAYVESE* |
Ga0115371_112093022 | 3300008470 | Sediment | MSFGMDPPAHRTKSTLPTSFKTPEFFEKSPLSGAGKHPDFMVTSCHHFDTTNADFAYIESE* |
Ga0115863_10299251 | 3300009034 | Sediment, Intertidal | MSELFKKSPPPEAEKHPDFQVTVCHHFDTTNVDFAYIESE* |
Ga0115863_10341183 | 3300009034 | Sediment, Intertidal | MTEFFEKSSLSGAGKHSDFQVTSCHHFDTTNVNFAYIESE* |
Ga0115863_10741932 | 3300009034 | Sediment, Intertidal | MLQFIEKSPLSGAGKHPDIQVTLCLQNVSTDVNFAYIESE* |
Ga0115863_10836922 | 3300009034 | Sediment, Intertidal | MPEFFEKTPLSGAEKHPDFQVTSCHQNDTTNVNFAYIKSE* |
Ga0115863_10892583 | 3300009034 | Sediment, Intertidal | MPEFFEKSPLSAAEKHPDFQVTVFLQNVTTNVDFAYIESE* |
Ga0115863_11780164 | 3300009034 | Sediment, Intertidal | MAVESCKKTPEFLKKSHLSGAGKHPDFQVTLCLQNVSTNADFAYIESE* |
Ga0115863_11999831 | 3300009034 | Sediment, Intertidal | KSPLSGAEKHHNFQVTSCHQNVSTNVDFAYIKSE* |
Ga0115863_13055312 | 3300009034 | Sediment, Intertidal | MKLSRLENCKMPEFFEMSLLSEARKHHNFQVTVCLQNVSTNVDFAYIESE* |
Ga0115863_13800401 | 3300009034 | Sediment, Intertidal | MSCKIPEFFENSPLSEAEKHPDFQVTLCIQNVTTNTDFAYIESE* |
Ga0115863_16218032 | 3300009034 | Sediment, Intertidal | MNCKIPQFFEKSPLSGAEKHPDLQVTSCLRFVTTNIKFNVLW |
Ga0115863_17457771 | 3300009034 | Sediment, Intertidal | TANKCPQNNPIFTSCKMPEFLEKSLLSEAKKHPDFQVTLCLHFVTTNVDFAYIGSE* |
Ga0118736_101061612 | 3300009135 | Marine Sediment | FMHCKIPEFFEISPLSGAGKHPDFQVTSCHHFDTTNADFAYIESE* |
Ga0118736_101297612 | 3300009135 | Marine Sediment | METLKIVTMHHENDPIFMHRKMLEFFEKTPLSETEKHPDFQETSCHQNFSTNIDFAYIKS |
Ga0118736_101462922 | 3300009135 | Marine Sediment | MPDFFKMSPLSGAKKHPDFQVTACLHFDTTIINFAYIESE* |
Ga0114921_100495001 | 3300009150 | Deep Subsurface | IFTSYKMPKFSEKLPLSGAEKHADFQVTSCLQNVSTNVDFAYIKSE* |
Ga0114921_100976174 | 3300009150 | Deep Subsurface | FEMSPLSGAGKHPDFLVTSCHHFVTTDVDFAYIESE* |
Ga0114921_101108311 | 3300009150 | Deep Subsurface | FEKSHLSGAGKHPDFQVTSCHQNVSTNVDFAYIESE* |
Ga0114921_101261182 | 3300009150 | Deep Subsurface | ESLKKAHLSGAGKHPDFQVTSCLHFVTTNVDFAYIESE* |
Ga0114921_101270163 | 3300009150 | Deep Subsurface | MPEFFEKSLLSGAGKHHNFQVTSCLHFVTTNVDFA |
Ga0114921_102413781 | 3300009150 | Deep Subsurface | QTKGTIPTNCKIPEFFEKSPLSGAGKHPDFQVTSCHHFVSTNVNFAYIKSE* |
Ga0114921_103049781 | 3300009150 | Deep Subsurface | EFFEKSPLSGTGKHPDFQVTLCLHFVTTNVDFAYIKSE* |
Ga0114921_104191723 | 3300009150 | Deep Subsurface | IFMICKTPEFFEKSPLSGAGKHPDFQVTLCHQNVSTDVDFAYIESE* |
Ga0114921_105088771 | 3300009150 | Deep Subsurface | KMPEFFEKSPLSGAGKHPDFQVTLCLHFDTTNVDFAYIESE* |
Ga0114921_105588631 | 3300009150 | Deep Subsurface | RESYKIPEFFENSPFSGVEKYPDFQVTSCHQNDTTNINFAYIESE* |
Ga0114921_105690541 | 3300009150 | Deep Subsurface | NIPLSCKMPEFFKKSPLSGAGKHPDFQVTFCLQNVSTNVNFAYSESE* |
Ga0114921_106268232 | 3300009150 | Deep Subsurface | MNCKIPEFLEKSPLSEAAKQPDFQVTSCHHFDTTNVDFAHIESE* |
Ga0114921_106554342 | 3300009150 | Deep Subsurface | YPVDMAVESCKKTPEFFEKSPLSGAEKHHNFQVTSYHHFDTANVDFAYIESE* |
Ga0114921_106854002 | 3300009150 | Deep Subsurface | EKPPLSGAKKHPDFQVTSCLHFDSTNIDFAYIESE* |
Ga0114921_106896221 | 3300009150 | Deep Subsurface | SEFFEMSPLSGAEKYHDSTVTSCLRFVTKDINFEDL* |
Ga0114921_107927941 | 3300009150 | Deep Subsurface | VSVKTSEFFEKSPLSEAGKHHNFQVTLCLQNVSTNADFAYIE |
Ga0114921_108554051 | 3300009150 | Deep Subsurface | EKSPLSRAKKHPDFQVTLCLHFVTTNVDFVYIESE* |
Ga0114921_111837511 | 3300009150 | Deep Subsurface | KSEITDKKSPLSGAEKHPYFQVTLCLHFVTTDVDFAYIESE* |
Ga0114925_100224743 | 3300009488 | Deep Subsurface | MSDITDAKSPLSGAEKHTDFQVTLCLQNVTTNVDFAYIESE* |
Ga0114925_103720421 | 3300009488 | Deep Subsurface | KSPLSGAEKHPDFQVTSCHHFVTTYANFAYIESE* |
Ga0114925_106761251 | 3300009488 | Deep Subsurface | KRQFSKAEKHPDFQVTSCHHFVTTNPKFTYIKSE* |
Ga0114925_114104531 | 3300009488 | Deep Subsurface | KSPLSEAEKHPDFQVTSCLHFVTTNVDFAYIESK* |
Ga0114930_100022864 | 3300009499 | Deep Subsurface | MPEFFKKSPFSGAEKHPDFQVTSCHHFDTTNADFAYIESE* |
Ga0114920_100609451 | 3300009528 | Deep Subsurface | KSPLSVSGKHPDLQVTFCHQNVTTNGNFAYIESE* |
Ga0114920_101327491 | 3300009528 | Deep Subsurface | IFYGCKMPGFFEKSHLSGAGKHPDFRVTSCHHFDTTNVDFAYIESE* |
Ga0114920_108245601 | 3300009528 | Deep Subsurface | DEIVDVRESCKTSEFFEKSPLSGAGKHPDFQVTLCLHFVTTDVDFAYIESE* |
Ga0114920_109024411 | 3300009528 | Deep Subsurface | MNCKTPEFFKNPPHSRAEKHPDFQVTSCHHFVTTYAIF |
Ga0118733_1002576321 | 3300010430 | Marine Sediment | LICNKIPEFLENSPLSEAGKHPDFQVTSCHHFDTTNANFA |
Ga0118733_1010519691 | 3300010430 | Marine Sediment | EKPPLSEAEKHPDFQVTSCHQNDTTNADFAYIESE* |
Ga0118733_1010967031 | 3300010430 | Marine Sediment | RATKHYNFQVTSCLQNDTTSVDFAYIESEFEGLI* |
Ga0118733_1030823603 | 3300010430 | Marine Sediment | FTSLKIPESFERSSHSETEKHPDFRVTLCLQNDTTSVDFAYIESE* |
Ga0118733_1086096271 | 3300010430 | Marine Sediment | MSFKIPELLEKSPLSEAEKHPNFQVTSCHQNDSTNI |
Ga0118733_1095378501 | 3300010430 | Marine Sediment | MAPFSGAVKHPDFQVTSCHQNDTTNVNFAYIESE* |
Ga0164321_100082392 | 3300014903 | Marine Sediment | MPEFFEKSSLSGAEKHRQNKVTSCHQNDTTNVDFAYIE |
Ga0164321_100250441 | 3300014903 | Marine Sediment | EKSPLSETGKHLDFQVTSCHHFVTTNAEFAYIESE* |
Ga0164321_100280002 | 3300014903 | Marine Sediment | MSESIKKPPFSGTEKHPDFQVTSCHHFDTTNVDFAYIESE* |
Ga0164321_101102322 | 3300014903 | Marine Sediment | GVIDSFALNCKMPEFFEKSPFSGTKKYPDFQVTSCLHFVTTNVNFAYIESE* |
Ga0164321_104777321 | 3300014903 | Marine Sediment | KSPLSGAEKHPDFQVTLCLQNDTTNPNFAYIESE* |
Ga0164321_107036841 | 3300014903 | Marine Sediment | EFFEKTPLS*ARKHPDFKVTLCHQNISTNVDFAYTESE* |
Ga0224506_104830301 | 3300022221 | Sediment | GPIFIHCKMPKFLEKSPLSEAGKHPDFQVTVCLHFVTTNVDFAYIESE |
Ga0209978_100093483 | 3300024263 | Deep Subsurface | MRSKKSEFFEKSPLSGAEKHPDFQVTSCLHFVTTDAIFAYIESE |
Ga0209978_100290781 | 3300024263 | Deep Subsurface | MKLSMSESCKMPEFFEMSPRSGAGKYPDLQVTSCHHFDTTNVNFAYIEFE |
Ga0209978_100317983 | 3300024263 | Deep Subsurface | MPEFFEKSPLSGAGKHPDFQVTSCHHFVTTNVDFAYIESE |
Ga0209978_100969942 | 3300024263 | Deep Subsurface | ENDPIFMHRKMPEFFAKSPLSGAGKHPDFQVTLCLQNVSTNVDFAYIESE |
Ga0209978_101733152 | 3300024263 | Deep Subsurface | FEKLFLSEAGKHPDFQVTSCHQNDSITIDFAYIESE |
Ga0209978_103963591 | 3300024263 | Deep Subsurface | MNCKIPEFLEKSPLSEAAKQPDFQVTSCHHFDTTNVDFAHIESE |
Ga0209978_104898361 | 3300024263 | Deep Subsurface | MAPFSRAVKMPEFFEMSPLSGSKKHPDFQVTSCHQNVSTNVDFAYL |
Ga0209978_105434841 | 3300024263 | Deep Subsurface | TNSTLSGAGKHPDFQVTSCHHFVTTNVVFAYIESE |
Ga0209979_10058043 | 3300024353 | Deep Subsurface | MPEFFKKSPFSGAEKHPDFQVTSCHHFDTTNADFAYIESE |
Ga0209977_100120764 | 3300024432 | Deep Subsurface | PEFFEKPPLSGAGKHHNFQVTSCHQNVSTNADFAYIESE |
Ga0209977_100786291 | 3300024432 | Deep Subsurface | SFTLSCKMSEFFEKPPFSGAEKHPDFQVTACLRFVSTDVNSYEL |
Ga0209977_105537121 | 3300024432 | Deep Subsurface | MPEFFNKSPLSGAEKHPDFQVTSCHQNVSTNVDFAYIKS |
(restricted) Ga0233415_102284421 | 3300027861 | Seawater | VREAQRGISEFFEKPSLSGAEKHPDFRVTSCLHFDTTNVDFAYIKSE |
(restricted) Ga0255052_105557782 | 3300027865 | Seawater | QEQMLTRITQFFLSCQTPAFFENSPLSGAGKHPDFQVTSCHHFDTTNVNFTDIESE |
Ga0209635_100668711 | 3300027888 | Marine Sediment | VTSNVSEYLKNSTLSAAKKHPDFQVTLCIHFVTTNVKFKG |
Ga0209635_100776521 | 3300027888 | Marine Sediment | MPEFYEKSLLSGAGKQPDFQVTFYHHFVTTNIKFAYIESE |
Ga0209635_102726542 | 3300027888 | Marine Sediment | MPEFFEKSPLSGAEKQPDFQVTSCHHFVTTNVDFAYIEFE |
Ga0209635_105676761 | 3300027888 | Marine Sediment | MNGKTPEFFKKPPLPGAEKHPDFQVTSCHQNVSTSVDFVYIEAE |
Ga0209427_101981862 | 3300027901 | Marine Sediment | MAVESCKKTPEFFKKPPLSRAEKHPDFQVTSCHHFDTTNVDFA |
Ga0209427_104915491 | 3300027901 | Marine Sediment | LSKIAEFFSKSPISRAEKHPDLQVTLCLQNVTTNVDFAYIKSEKMLFFAKI |
Ga0209427_105323432 | 3300027901 | Marine Sediment | MPEFFEKLPFSEAKKHPDFQVTSCRHFDTTDVDFAYI |
Ga0209536_1021563531 | 3300027917 | Marine Sediment | KKSPLSLAAKHPNFRVTLCSQNDTTNIDFAYIESE |
Ga0307427_10205243 | 3300031351 | Salt Marsh | MPEFFEKSLLLRAEKHPDFQVTLCLRFVTTDVDFAYIKSE |
Ga0307439_10116382 | 3300031356 | Salt Marsh | MPEFFEKSPLLGAEKYPDFQVTLCLRNDTTNVDFAYIESE |
Ga0307380_100116069 | 3300031539 | Soil | MSKFFAKSTFSGAEKHPDFQVTSCLRNVSTDVNFTYIESE |
Ga0307380_100170333 | 3300031539 | Soil | MSEFFEKSLLSGAGKHPDFQVTLCLHFVTTNVDFAYIKSE |
Ga0307380_100501004 | 3300031539 | Soil | MPEFLEKSRLSVAGKHLDFQVTSCHHFVSTDVDFAYIESE |
Ga0315548_10529822 | 3300031551 | Salt Marsh Sediment | MPEFFEKLPLSGAEKHLDFQVTSCHRFISTNVDFAYIESE |
Ga0315548_12604881 | 3300031551 | Salt Marsh Sediment | MSDITDEKSHFQGAQKHTDFKVTLXLHFVTTNVNLAYI |
Ga0307379_100720393 | 3300031565 | Soil | MSIRENCKMSEFFEKSLLSGAGKHPDFQVTLCLHFVTTNVDFAYIKSE |
Ga0315539_10107641 | 3300031650 | Salt Marsh Sediment | MPEFIEKSPLLEAEKHPDFQVTSCHRFVSTNVDFAYIESE |
Ga0316193_115159221 | 3300033429 | Sediment | LPTSCKMPEAFEVSPLSEAKKHPDFQVTPCYQNDTTKLNFAYIES |
⦗Top⦘ |