Basic Information | |
---|---|
Family ID | F094923 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 42 residues |
Representative Sequence | MSDHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 72.38 % |
% of genes near scaffold ends (potentially truncated) | 14.29 % |
% of genes from short scaffolds (< 2000 bps) | 71.43 % |
Associated GOLD sequencing projects | 54 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.952 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (53.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (85.714 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (92.381 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF04404 | ERF | 20.00 |
PF11753 | DUF3310 | 6.67 |
PF07335 | Glyco_hydro_75 | 5.71 |
PF08774 | VRR_NUC | 2.86 |
PF01242 | PTPS | 0.95 |
PF13489 | Methyltransf_23 | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.95 % |
All Organisms | root | All Organisms | 39.05 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 53.33% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.86% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 4.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.81% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.86% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.95% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.95% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.95% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.95% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.95% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0049080_100547063 | 3300005582 | Freshwater Lentic | MSDHDDLVARANRTMRAIRTMVRIILVSAILGLLWLLWRLCA* |
Ga0049080_101772812 | 3300005582 | Freshwater Lentic | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRICQ* |
Ga0104986_127311 | 3300007734 | Freshwater | MNNHDPDLVARANRTMSCIRTMVRIILVTGILGLLWLLWRLWL* |
Ga0114973_100434763 | 3300009068 | Freshwater Lake | MSDHDPDLVARANRTMRAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0114973_101161423 | 3300009068 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ* |
Ga0114962_100252595 | 3300009151 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLGA* |
Ga0114962_101048574 | 3300009151 | Freshwater Lake | MDHDPDLVERANRTMSAIRTMIRIILTSAILGLLWLLWRMGA* |
Ga0114962_101694951 | 3300009151 | Freshwater Lake | DPDLVARATRTMSAIRTMIRIILVSAILGLLWLLWRLCQ* |
Ga0114980_101016814 | 3300009152 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIILVSAILGLLWLLWRLCA* |
Ga0114963_106816062 | 3300009154 | Freshwater Lake | MDDDKDLVARSNRTMAAIRTMIRIIRVSAILGLLWLLWRLCA* |
Ga0114968_1001203211 | 3300009155 | Freshwater Lake | MSDHDPDLVARANRTMRAIRTMIRIVLTTAIIGLLWLLWRYWL* |
Ga0114968_100313318 | 3300009155 | Freshwater Lake | MSDHDDLVARANKTMRAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0114968_101449802 | 3300009155 | Freshwater Lake | MDHDPDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ* |
Ga0114968_102527023 | 3300009155 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIILTTAILGLLWLLWRLCA* |
Ga0114968_104420642 | 3300009155 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIILISAILGLLWLLWRLL* |
Ga0114977_103922292 | 3300009158 | Freshwater Lake | MIDHDPDLVARANRTMSAIRTMVRIILVSAILGLLWLLWRLCS* |
Ga0114978_100387703 | 3300009159 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIILTTAILGLLWLLWRICA* |
Ga0114966_100538224 | 3300009161 | Freshwater Lake | MSDNDPDLVARANRTMRAIRTMIRIVLTSAILGLLWLLWRLCE* |
Ga0114966_100958363 | 3300009161 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0114966_101304133 | 3300009161 | Freshwater Lake | MSDHDDLVARANRTMSAIRTMVRIILVSAILGLLWLLWRLCA* |
Ga0114970_100286586 | 3300009163 | Freshwater Lake | MDHDNDLVARANRTMAAIRTMIRIILTSAILGLLWLLWRLCA* |
Ga0114970_104420142 | 3300009163 | Freshwater Lake | MIDHDPDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0114970_107063962 | 3300009163 | Freshwater Lake | MSDHDPDLVTRANRTMRAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0114975_102779662 | 3300009164 | Freshwater Lake | MSDHDPDLVARANRTMSAIRTMIRIILTTAILGLLWLLWRICA* |
Ga0114969_102180634 | 3300009181 | Freshwater Lake | MIDHDPDLVARANRTMSAIRTMIRIILTTAILGLLWLLWRLCA* |
Ga0114969_102388663 | 3300009181 | Freshwater Lake | MDHDPDLVARANKTMSAIRTMIRIVLTSAIIGLLWLLWRLCA* |
Ga0114959_100752895 | 3300009182 | Freshwater Lake | MIDHDPDLVARATRTMSAIRTMIRIILVSAILGLLWLLWRLCQ* |
Ga0114971_104088712 | 3300009185 | Freshwater Lake | MIDHDPDLVARANRTMRAIRTMIRIVLTTAIIGLLWLLWRYWL* |
Ga0114958_105097292 | 3300009684 | Freshwater Lake | MIDHDPDLVTRANKTMSAIRTMIRIVLVTAILGLLWLLWRYWL* |
Ga0114967_103603122 | 3300010160 | Freshwater Lake | MSDHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA* |
Ga0114967_106320341 | 3300010160 | Freshwater Lake | DHDPDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ* |
Ga0133913_119047063 | 3300010885 | Freshwater Lake | MIEHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA* |
Ga0139557_10121452 | 3300011010 | Freshwater | MSHDPDLVARANRTMKAIRTMIRIILTTAILGLLWLLWRLCA* |
Ga0139556_10299202 | 3300011011 | Freshwater | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRLHA* |
Ga0153698_18354 | 3300011335 | Freshwater | MNNHDPDLVARANRTMSAIRTMVRIILTTAILGLLWLLWRLCA* |
Ga0153799_10107764 | 3300012012 | Freshwater | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRLCQ* |
Ga0153799_10619002 | 3300012012 | Freshwater | MSDHDPDLVARANRTMAAIRTMIRIILISAILGLLWLIWRLCQ* |
Ga0138276_12398764 | 3300012768 | Freshwater Lake | MSDRDDLVARANKTMRAIRTMIRIVLTSAILGLLWLLWRLCA* |
Ga0138284_10991374 | 3300012779 | Freshwater Lake | MIDHDPDLVALANRTMSAIRTMVRIILVSAILGLLWLLWRLCS* |
Ga0177922_101833112 | 3300013372 | Freshwater | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRICA* |
Ga0119960_10515582 | 3300014811 | Aquatic | MSHDPDIVARANRTMKAIRTMIRIILISAILGLLWLLWRLCA* |
Ga0181364_10435212 | 3300017701 | Freshwater Lake | MDADKDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCQ |
Ga0181347_10707223 | 3300017722 | Freshwater Lake | PEHSTLMDHDPDLVARANRTMAAIRTMIRIVLTSAILGLLWLLWRICQ |
Ga0181347_12024311 | 3300017722 | Freshwater Lake | MDADKDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRICQ |
Ga0181362_10087224 | 3300017723 | Freshwater Lake | MSNHDPDLVARANRTMSAIRTMIRIILTSAILGLLWLLWRLCA |
Ga0181362_10708672 | 3300017723 | Freshwater Lake | MDHDPDLVARANKTMSAIRTMIRIMLTTAILGLLWLLWRLCA |
Ga0181362_11112942 | 3300017723 | Freshwater Lake | MSDHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA |
Ga0181365_10793362 | 3300017736 | Freshwater Lake | MSDHDPDLVARANRTMAAIRTMVRIILTTAILGLLWLLWRICQ |
Ga0181365_10822092 | 3300017736 | Freshwater Lake | MIDHDPDLVARANRTMAAIRTMVRIILTTAILGLLWLIWRICQ |
Ga0181365_11047022 | 3300017736 | Freshwater Lake | MSDHDPDLVARANRTMAAIRTMIRIILISAILGLLWLIWRLCQ |
Ga0181356_11637282 | 3300017761 | Freshwater Lake | HSTLMDHDPDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRICQ |
Ga0181358_12043072 | 3300017774 | Freshwater Lake | YPEHEMSHDPDLVARANRTMKAIRTMIRIILTTAILGLLWLLWRLCA |
Ga0181357_12639281 | 3300017777 | Freshwater Lake | MSDYDPDLVARANRTMAAIRTMIRIILVSAILGLLWLLWRLHA |
Ga0181349_11600592 | 3300017778 | Freshwater Lake | MDHDPDLVARANRTMKAIRTMVRIILTTAILGLLWLLWRICQ |
Ga0181346_11481983 | 3300017780 | Freshwater Lake | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRLCA |
Ga0181355_11303151 | 3300017785 | Freshwater Lake | MMSDHDPDLVARANKTMSAIRTMVRIILISAILGLLWLLWRLCA |
Ga0181355_13919932 | 3300017785 | Freshwater Lake | MSDHDPDLVARANRTMSAIRTMVRIILTTAILGLLWLLWRLCA |
Ga0181359_10599543 | 3300019784 | Freshwater Lake | MSHDPDLVARANRTMAAIRTMIRIILVSAILGLLWLIWRLWA |
Ga0181359_11353831 | 3300019784 | Freshwater Lake | MDHDPDLVARANRTMSAIRTMVRIILTTAILGLLWLL |
Ga0181359_12293212 | 3300019784 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIVLTSAILGLLWLLWRLCA |
Ga0194045_11689212 | 3300021516 | Anoxic Zone Freshwater | PKHNAMSDHDDLVARANKTMSAIRMMIRIVLTSAILGLMWLLWRLHA |
Ga0194048_100050428 | 3300021519 | Anoxic Zone Freshwater | MDADKDLVARANRTMAAIRTMIRIILVSAILGLLWLLWRICA |
Ga0194048_1000712610 | 3300021519 | Anoxic Zone Freshwater | MDADKDLVARANRTMAAIRTMIRIILTSAILGLLWLLWRLCQ |
Ga0194048_100116985 | 3300021519 | Anoxic Zone Freshwater | MDADKDLVARANRTMSAIRTMIRIILSTAILGLLWLLWRYWL |
Ga0194048_101101022 | 3300021519 | Anoxic Zone Freshwater | MSDHDDLVARANKTMSAIRTMIRIILTSAILGLLWLLWRLCA |
Ga0222712_107272471 | 3300021963 | Estuarine Water | DLVARANKTMSAIRTMIRIILVSAILGLLWLIWRICA |
Ga0181351_10627371 | 3300022407 | Freshwater Lake | MSDHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRICQ |
Ga0181351_11484192 | 3300022407 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIILTTAILGLLWLLWRICQ |
Ga0181351_12432922 | 3300022407 | Freshwater Lake | MSDHDQDMVARANRTMKAIRTMVRIILTTAILGLLWLLWRICQ |
Ga0214919_100720303 | 3300023184 | Freshwater | MDHDPDLVARANKTMSAIRTMVRIILTSAILGLLWLLWRLCA |
Ga0244775_102430064 | 3300024346 | Estuarine | MIDHDPDLVARANRTMACIRTMIRIILVSAILGLLWLLWRVWL |
Ga0208916_100067032 | 3300025896 | Aqueous | MIDHDPDLVARANRTMKAIRTMIRIILTTAILGLLWLLWRLVA |
Ga0208974_10152625 | 3300027608 | Freshwater Lentic | MSDHDDLVARANRTMRAIRTMVRIILVSAILGLLWLLWRLCA |
Ga0209188_11584792 | 3300027708 | Freshwater Lake | MIDHDPDLVARATRTMSAIRTMIRIILVSAILGLLWLLWRLCQ |
Ga0209297_10224156 | 3300027733 | Freshwater Lake | MSDHDPDLVARANRTMSAIRTMIRIILTTAILGLLWLLWRICA |
Ga0209087_12098102 | 3300027734 | Freshwater Lake | MIDHDPDLVARANRTMSAIRTMVRIILVSAILGLLWLLWRLCS |
Ga0209190_10303201 | 3300027736 | Freshwater Lake | DLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ |
Ga0209190_10311354 | 3300027736 | Freshwater Lake | MIDHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA |
Ga0209190_10348524 | 3300027736 | Freshwater Lake | MDHDNDLVARANRTMAAIRTMIRIILTSAILGLLWLLWRLCA |
Ga0209190_10423323 | 3300027736 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIILTTAILGLLWLLWRLCA |
Ga0209190_10692161 | 3300027736 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ |
Ga0209190_10752851 | 3300027736 | Freshwater Lake | MDHDPDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCQ |
Ga0209190_13208452 | 3300027736 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIILISAILGLLWLLWRLL |
Ga0209085_13170692 | 3300027741 | Freshwater Lake | MDDDKDLVARSNRTMAAIRTMIRIIRVSAILGLLWLLWRLCA |
Ga0209189_11652111 | 3300027747 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRL |
Ga0209084_12437721 | 3300027749 | Freshwater Lake | DPDLVARATRTMSAIRTMIRIILVSAILGLLWLLWRLCQ |
Ga0209084_12839102 | 3300027749 | Freshwater Lake | MDHDPDLVERANRTMSAIRTMIRIILTSAILGLLWLLWRMGA |
Ga0209596_100372016 | 3300027754 | Freshwater Lake | MSDHDDLVARANKTMRAIRTMIRIVLTSAILGLLWLLWRLCA |
Ga0209596_10189329 | 3300027754 | Freshwater Lake | MIDHDPDLVARANRTMAAIRTMIRIVLTSAILGLLWLLWRLCA |
Ga0209596_10476975 | 3300027754 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMIRIVLTSAILGLLWLLWRLCA |
Ga0209596_11412913 | 3300027754 | Freshwater Lake | MDHDPDLVARANKTMSAIRTMIRIVLTSAIIGLLWLLWRLCA |
Ga0209596_11486522 | 3300027754 | Freshwater Lake | MSDHDDLVARANRTMSAIRTMVRIILVSAILGLLWLLWRLCA |
Ga0209088_102121792 | 3300027763 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIILTTAILGLLWLLWRICA |
Ga0209086_101124661 | 3300027770 | Freshwater Lake | MIEHDPDLVARANRTMAAIRTMIRIILTTAILGLLWLLWRLCA |
Ga0209500_100227264 | 3300027782 | Freshwater Lake | MSDHDDLVARANKTMSAIRTMVRIILVSAILGLLWLLWRLCA |
Ga0209500_101239742 | 3300027782 | Freshwater Lake | MSDHDPDLVARANRTMRAIRTMVRIILTTAILGLLWLLWRLCA |
Ga0209246_101429232 | 3300027785 | Freshwater Lake | MSDHDPDLVARANRTMAAIRMMIRIILVSAILGLLWLLWRLCA |
Ga0209354_100948091 | 3300027808 | Freshwater Lake | MDADKDLVARANRTMAAIRTMIRIILTSAILGLLWLIWRLCQ |
Ga0209400_10058505 | 3300027963 | Freshwater Lake | MSDHDPDLVARANRTMRAIRTMIRIVLTTAIIGLLWLLWRYWL |
Ga0304728_12901142 | 3300028393 | Freshwater Lake | MIDHDPDLVARATRTMSAIRTMIRIILVSAILGLLWLL |
Ga0315293_107435301 | 3300031746 | Sediment | MIDHDPDLVARANRTLACIRTMIRIILTTAILGLLWLLWRLCA |
Ga0334722_103545223 | 3300033233 | Sediment | MHDDDPDIVARANRLMSAIRTMIRIILTSAILGLLWLIWRICS |
Ga0334979_0471977_553_681 | 3300033996 | Freshwater | MSHDPDLVARANRTMSCIRTMIRIILVSAIIGLLWLIWRLWL |
Ga0334986_0003425_3520_3648 | 3300034012 | Freshwater | MSHDPDLVARANRTMAAIRTMIRVILTTAILSLLWLIWRLCA |
Ga0335058_0404316_675_782 | 3300034121 | Freshwater | VARANRTMAAIRTMIRVILTTAILSLLWLIWRLCA |
⦗Top⦘ |