NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095450

Metagenome Family F095450

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095450
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 125 residues
Representative Sequence MSKIKLNKVVLENVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKVNNSTYQYVEGSENRDNGCIVNSITGHVCNVSYLGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Number of Associated Samples 60
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 40.00 %
% of genes from short scaffolds (< 2000 bps) 82.86 %
Associated GOLD sequencing projects 58
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(51.429 % of family members)
Environment Ontology (ENVO) Unclassified
(98.095 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.19%    β-sheet: 26.58%    Coil/Unstructured: 58.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00856SET 3.81
PF12779WXXGXW 1.90
PF13585CHU_C 1.90
PF00085Thioredoxin 0.95



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.33 %
UnclassifiedrootN/A6.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10005903All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6319Open in IMG/M
3300006565|Ga0100228_1080787Not Available955Open in IMG/M
3300006750|Ga0098058_1091767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300006751|Ga0098040_1189977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300006752|Ga0098048_1144300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300006752|Ga0098048_1233556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300006753|Ga0098039_1288475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300006926|Ga0098057_1133041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300006928|Ga0098041_1259726All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300006929|Ga0098036_1143088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium731Open in IMG/M
3300008050|Ga0098052_1146873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium936Open in IMG/M
3300008050|Ga0098052_1249840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300008050|Ga0098052_1371188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300010149|Ga0098049_1201180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300010151|Ga0098061_1215219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium677Open in IMG/M
3300010151|Ga0098061_1282048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium574Open in IMG/M
3300010151|Ga0098061_1325502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300010153|Ga0098059_1368878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300010153|Ga0098059_1384348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300010155|Ga0098047_10397776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium516Open in IMG/M
3300014959|Ga0134299_1064463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300017703|Ga0181367_1063196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium645Open in IMG/M
3300017704|Ga0181371_1030560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium886Open in IMG/M
3300017705|Ga0181372_1016741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1267Open in IMG/M
3300017705|Ga0181372_1017628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300017705|Ga0181372_1022373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1079Open in IMG/M
3300017706|Ga0181377_1030668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1114Open in IMG/M
3300017706|Ga0181377_1037980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium964Open in IMG/M
3300017706|Ga0181377_1097417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300017709|Ga0181387_1018552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1349Open in IMG/M
3300017713|Ga0181391_1001999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5844Open in IMG/M
3300017717|Ga0181404_1121595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium636Open in IMG/M
3300017718|Ga0181375_1049536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300017718|Ga0181375_1074694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300017721|Ga0181373_1015187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1438Open in IMG/M
3300017721|Ga0181373_1062674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium668Open in IMG/M
3300017721|Ga0181373_1077142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium593Open in IMG/M
3300017724|Ga0181388_1006214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3209Open in IMG/M
3300017725|Ga0181398_1071751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium831Open in IMG/M
3300017728|Ga0181419_1066064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium921Open in IMG/M
3300017728|Ga0181419_1148710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300017731|Ga0181416_1134054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium596Open in IMG/M
3300017732|Ga0181415_1066860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium814Open in IMG/M
3300017735|Ga0181431_1154531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300017739|Ga0181433_1172171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300017742|Ga0181399_1019766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1892Open in IMG/M
3300017743|Ga0181402_1074114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium896Open in IMG/M
3300017743|Ga0181402_1108078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300017746|Ga0181389_1059257All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1102Open in IMG/M
3300017748|Ga0181393_1133220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium625Open in IMG/M
3300017751|Ga0187219_1059894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1235Open in IMG/M
3300017751|Ga0187219_1151738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300017753|Ga0181407_1013895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2275Open in IMG/M
3300017753|Ga0181407_1143366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium591Open in IMG/M
3300017757|Ga0181420_1004017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5249Open in IMG/M
3300017757|Ga0181420_1007806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3698Open in IMG/M
3300017757|Ga0181420_1061699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1190Open in IMG/M
3300017757|Ga0181420_1063045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1175Open in IMG/M
3300017757|Ga0181420_1189935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300017757|Ga0181420_1244415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300017760|Ga0181408_1079254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium861Open in IMG/M
3300017760|Ga0181408_1136825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium632Open in IMG/M
3300017760|Ga0181408_1145316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium612Open in IMG/M
3300017760|Ga0181408_1156077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300017762|Ga0181422_1071914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1095Open in IMG/M
3300017764|Ga0181385_1010461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2996Open in IMG/M
3300017764|Ga0181385_1052633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1266Open in IMG/M
3300017767|Ga0181406_1101168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium872Open in IMG/M
3300017770|Ga0187217_1107706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium946Open in IMG/M
3300017770|Ga0187217_1302042Not Available515Open in IMG/M
3300017773|Ga0181386_1066301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1147Open in IMG/M
3300017773|Ga0181386_1069852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1113Open in IMG/M
3300017773|Ga0181386_1078775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1039Open in IMG/M
3300017773|Ga0181386_1148065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium718Open in IMG/M
3300017775|Ga0181432_1002219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4295Open in IMG/M
3300017775|Ga0181432_1003439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3568Open in IMG/M
3300017775|Ga0181432_1055479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1117Open in IMG/M
3300017775|Ga0181432_1073515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium990Open in IMG/M
3300017775|Ga0181432_1075006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium981Open in IMG/M
3300017775|Ga0181432_1081558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium946Open in IMG/M
3300017775|Ga0181432_1160931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium693Open in IMG/M
3300017779|Ga0181395_1140825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium762Open in IMG/M
3300017781|Ga0181423_1049180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1686Open in IMG/M
3300020312|Ga0211542_1057287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium710Open in IMG/M
3300020403|Ga0211532_10354567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300020411|Ga0211587_10308694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300020451|Ga0211473_10486245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium629Open in IMG/M
3300020457|Ga0211643_10553256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium565Open in IMG/M
3300020465|Ga0211640_10371302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium788Open in IMG/M
3300020470|Ga0211543_10012983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4820Open in IMG/M
3300020470|Ga0211543_10046959All Organisms → Viruses → Predicted Viral2296Open in IMG/M
3300020470|Ga0211543_10152871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1158Open in IMG/M
3300020470|Ga0211543_10408044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300025112|Ga0209349_1057582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1195Open in IMG/M
3300025141|Ga0209756_1104312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1217Open in IMG/M
3300025151|Ga0209645_1121937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300025168|Ga0209337_1003647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium10827Open in IMG/M
3300025168|Ga0209337_1006596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7783Open in IMG/M
3300025168|Ga0209337_1198406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium818Open in IMG/M
3300028022|Ga0256382_1054976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater51.43%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine36.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.52%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.95%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.95%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300014959Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubationEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300020312Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020411Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_1000590363300001450MarineMSKVKLNKVELKNVKNVGVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYTDVNNKFKSGNLFKVNNCTYQYSEGSENRDNGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS*
Ga0100228_108078723300006565MarineMSKVKLNKVEVKVSKVVIDKEDGIHREDKRKNNPGRPVNKKSARYIRLQKQAFYADVNSKFQKGNQFKVDGSSSIYKYSAGKDGSLGCIVETVFNSHVCNVSYVGRTKVQAYSFTLGKKVNVELNLKTLKFVS*
Ga0098058_109176723300006750MarineMSKVKLNKVELKNVKNVGVLVVEKKGVAGTKDDKRTSNPGRPVNKQSARYKRLAKQAFYASVNSKFVKGNQFKVSNGQYNYSQPNNNNEYGCIVDSITGMHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK*
Ga0098040_118997713300006751MarineVGVLVAEKVSVAGTKNDKRKSNPGRPVNKKSARYKRLAKQAFYASVNSKFVKGNQFKLSNTDTETYTYKPSDNGLGCILSTVTGYVCNVSYIGRTKVQAFTFVLGKQVKVELNLKTLKFVS*
Ga0098048_114430013300006752MarineMSKIKLNKVEVKVSKVVIDKENGIHREDKRKNNPGRPVNKKSARYIRLQKQAFYANVNAKFKKGNQFKVNNSTYKYSPSKDGLGCIVNDIQGHVCNVSYVGRTKVQGYTFVLGKRVNVELNLKTLQFVS*
Ga0098048_123355613300006752MarineMSKLKLNKVEVKVSKVETVKVDKRKNNPGRPVNKKSARYIRLQKQAFYASVNDKFKKGNQFRIANNTYKYSAGKDGDLGCIINSISMHECNVSYIGRTKVQGYTFVLGKKVKVELNLKNV
Ga0098039_128847523300006753MarineMAKLKLNKVELKNVKNVGVLVVEKKGIAGTKDDKRTSNPGRPVNKQSARYKRLAKQAFYASVNSKFVKGNQFKVNSETYIYKPCANDSGTYGSIVSTVTGHVCNVDYIGRTKVQGYTFVLGKKVKVELNLKTLKFVSSKK*
Ga0098057_113304113300006926MarineMAKTKLNKVELKNVKNVGVLVVEKKGIAGTKDDKRTNNPGRPINKKSARYKRLAKQAFYASVNSKFKKGNQFQLNNTDVEKYTYKPSKDGLGCILSTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS*
Ga0098041_125972623300006928MarineMSKVKLNKVELKNVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNSKFVKGNQFKVSNSVYSYSQPNEHSEYGCIVNSITGHVCNVSYIGRTKVQGYTFVLGKKV
Ga0098036_114308813300006929MarineMSKIKLNKVELKNVDATIVEVKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNAKFKEGNQFKVSNSVYNYSQPNEHSEYGCIVNSISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS*
Ga0098052_114687313300008050MarineMSKIKLNKVELKNVDATIVEVKVDKRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFQLSNSDVEKYIYKPSNDSLGCILSTVTGHVCNVSYIGRTKVQGYTFVLGKQVKVELNLKNVKFVK*
Ga0098052_124984013300008050MarineIMSKVKLNKVVLENVDAVVVGVKVDKRKNNPGRPVNKQSARYKRLAKQAFYASVNSKFKKGNQFKVSNSVYNYSQPNEHSEYGCIVNSISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTVKFVK*
Ga0098052_137118813300008050MarineMSVKTKNQAVKLNKVVLNNVDAVVIGVAGTKDDKRTNNPGRPVNKKSARYKRLAKQAFYANVNSKFKKGNQFQLNNSDIEKYAYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVQGYTFVLGKKVNI
Ga0098049_120118013300010149MarineMSKLKNVVVLDKKVLKAIAKGETVKVDKRKNNPGRPVNKKSARYIRLQQQSWYETINAKFVNGNKFKINASSYSYSAGDNNSLGCIVDGIGSHECNVSYIGRTKVQGYKFVLGKKVKVELNLKTLKFVS*
Ga0098061_121521913300010151MarineGVLVAEKVDNRKNNPGRPVNKKSARYKRLAKQAFYADVNSKFVKGNQFKIGSSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLKFVS*
Ga0098061_128204813300010151MarineMSKIKLNKVELKNVKNVGVLVAEKVSVAGTKNDKRKSNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFQLSNSDVEKYIYKPSNDSLGCILSTVTGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS*
Ga0098061_132550213300010151MarineMTKLNKVVVVLDEKKIKEITEGKVDKRTLNTGRPVNKKSARQARLAKQAFYASVNDKFKKGNQFRVSGSSYYYSEGIENKDNGCIVDSITNMHVCNVSYIGRTKVQGYTFTLGKKVNVELNLKTLKFVS*
Ga0098059_136887813300010153MarineMSVKTKNQLNKVVVDVVTETKVDGRTNNPGRPVNKKSARYKRLAKQAFYASVNSKFVKGNQFKLSNETYAYKHNEGKHINDGSAYGCIVSTITGYVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS*
Ga0098059_138434823300010153MarineMSKIKLNKVELKNVDATIVEVKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNAKFKSGNLFKVNGSTYQYNEGSENVNSGCIVNSITGHVCNVDYIGRTKVKGYTFVLGKKVNVELN
Ga0098047_1039777613300010155MarineMSKTNKNQTVKLNKVELTNLPNVGVLKVGVAGTKDDKRTNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKLDNTDVETYTYKPSNDSLGCIVNAITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS*
Ga0134299_106446313300014959MarineMSKVKLNKVELKNVKNVGVLVVEKKVDNRTNNPGRPVNKQSARYKRLAKQAFYADVNNKFVSGKPFQLNGSSSIYKYKSMNDGKLGCIVETAFGMHTCNVSYIGRTKVQGYAFVMSKKVNIELNLKTLKFVS*
Ga0181367_106319613300017703MarineMSVKTKNQAVKLNKVELKNVKNVGVLVVEKKGVAGTKDDKRTSNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFTLNNLVGEKYVYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVQGYAFVLQKKVNVELNLKTLKFVS
Ga0181371_103056013300017704MarineMSVKTKNQAVKLNKVVLNNVDAVVIGVAGTKDDKRTNNPGRPVNKKSARYKRLAKQAFYANVNSKFKKGNQFQLNNSDIEKYAYNPSTNGNEYGCILSTITGHVCNISYIGRTKVQGYSFVLGKKVNVELNLKTLKFIK
Ga0181372_101674123300017705MarineMTKKTKLNKVVVEVSNVEKKIDKRKNNPGRPINKKSARYIRLQQQEWYETINAKFVNGNKFTIANNTYSYKPSNDGSLGCIVNSMSMHECNVSYIGRTKVLGFTYVLGKRVNVTINLKQVTFA
Ga0181372_101762823300017705MarineMAKLKLNKVELKNVKNVGVVVIDKEDGIHREDKRKNNPGRPVNKKSARYIRLQKQSFYNDVNNRFKKGNQFKVDGSTYAYKHYEGKHIQDGSEYGCIVNTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFTS
Ga0181372_102237313300017705MarineMSVKTKNQAVKLNKVVLNNVDAVVIGVAGTKDDKRTNNPGRPVNKKSARYKRLAKQAFYANVNSKFKKGNQFQLNNSDIEKYAYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVLGYTFVLGKQVKVELNLKTLNFVK
Ga0181377_103066823300017706MarineMSKLNKVVLENVVVEKKVDNRTNNPGRPVNKQSARYKRLAKQAFYADVNNKFKSGNLFKVNNTTYQYSEGSENRDNGCIVNSVTGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0181377_103798013300017706MarineMSKVKLNKVVLENVKNVGVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYADVNNKFKSGNLFKVNNSTYQYSEGSENRDNDCIVNSITGHVCNVSYIGRTK
Ga0181377_109741713300017706MarineMSKIKLNKVELKNVKNVGVLVVEKKVDKRTNNPGRPVNKKSARYKRLQKQAFYASVNSKFVKGNRFQLDGSSSVYKYSAGDNGLGCIVETAFNTHCANVSYIGRTKVQAYSFTLGKKVNVELNLKTLKFVS
Ga0181387_101855223300017709SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181391_1001999113300017713SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLKFVS
Ga0181404_112159513300017717SeawaterMSVKTKNQSVKLNKVELTNLPNVGVLKVGKTTHTVDRRKNNPGRPVNKKSARYKRLAKQKFYASVNSKFVKGNQFKVNASTYQYSEGNNNELGCIVNAVTGHVCNVSYIGRTKVQGF
Ga0181375_104953613300017718MarineMTKSKNQPVELKKVVVNVKPAANNDVKVDGRTNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFTLNNLVGEKYVYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVQGYAFVLQKKVNVELNLKTLKFVS
Ga0181375_107469413300017718MarineMSKLKLNKVELKNVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNAKFKEGNQFKVSNSVYNYSQPNEHSEYGCIVNTISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181373_101518713300017721MarineMTKKTKLNKVVVEVSNVEKKIDKRKNNPGRPINKKSARYIRLQQQEWYETINAKFVNGNKFTIANNTYSYKPSNDGSLGCIVNSMSMHECNVSYIGRTKVQGYSFTLGKKVKVELNLKTLKFVS
Ga0181373_106267413300017721MarineMSVKTKNQLNKVVVDVVTETKVDGRTNNPGRPVNKKSARYKRLAKQAFYASVNSKFVKGNQFKLSNETYAYKANEGKHIQDGSPYGCIVSTITGHVCNVDYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181373_107714223300017721MarineMSKIKLNKVELKNVDATIVEVKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNAKFKSGNLFKVNGSTYQYNEGSENVNSGCIVNSITGHVCNVDY
Ga0181388_100621493300017724SeawaterVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNDKFQKGNQFKIGSSVYSYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181398_107175113300017725SeawaterMTKLNKVVLKNVKNVGVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYADVNSKFKKGNQFKVNNSTYKYSAGKDNTLGCIVDIFTGSHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLQFIK
Ga0181419_106606413300017728SeawaterMSKLKLNKVELKNVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKVNNSTYQYVEGSENRDNGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLEFVK
Ga0181419_114871013300017728SeawaterIKLNKVELKNVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTLKFVS
Ga0181416_113114913300017731SeawaterMTKLNKVVLKNVKNVGVLVVEKKVDNRKNNPGRPVNKQSARYKRLAKQAFYADVNNKFVSGKPFQLNGSSSVYKYNAGDNGGLGCIVETAFNTHCANVSYVGRTKVQAYSFTLGKKVNVELNLKTLKFVK
Ga0181416_113405413300017731SeawaterVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTLKFVS
Ga0181415_106686013300017732SeawaterMTKLNKVTIEVKKENQPVKVDKRKFNTGRPVNKKSARYKRLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTSFS
Ga0181431_115453113300017735SeawaterGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNNKFKSGNLFKVNASTYQYSEGSENVNSGCIVNSVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181433_117217113300017739SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKNNELGCIVDMFTGSHVCNVDYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0181421_105242023300017741SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKEGNQFRVNNSTYQYVEGSENRDNGCIVNSITGHVCNVSYLGR
Ga0181399_101976613300017742SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNDKFQKGNQFKIGSSVYSYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKK
Ga0181402_107411413300017743SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVE
Ga0181402_110807813300017743SeawaterMSKIKLNKVVLENVKNVGVLVVEKKVDKRTNNPGRPVNKQSARYKRLAKQAFYTDVNNKFKSGNLFKVNNSTYQYSEGSENRDNGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0181402_114782513300017743SeawaterMSKIKLNKVELKNVKNVGVLVAEKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKEGNQFRVNNSTYQYIEGSENRDNGCIVNSITGHVCNVSY
Ga0181389_105925733300017746SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLG
Ga0181393_113322013300017748SeawaterMTKLNKVVLENVVVEKKVDNRTNNPGRPVNKQSARYKRLAKQAFYADVNSKFKSGKTFKVSNSEYNYSQPSNNNEYGCIVDGITNMHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVS
Ga0187219_105989413300017751SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYSNVNSKFEKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIEWKLKTLRFVS
Ga0187219_115173823300017751SeawaterMTKLNKVVLENVVVEKKVDNRTNNPGRPVNKQSARYKRLAKQAFYADVNSKFKSGKTFKVSNSEYNYSQPSNNNEYGCIVNNISGHVCNVSYIGRTKVKCYSFVLGKKVNVELNLKTL
Ga0181407_101389513300017753SeawaterMSKVKLNKVVLENVKNVGVLVVEKKVDKRKNIPGRPVNKKSDRYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181407_114336613300017753SeawaterMSKIKLNKVELKNVKNVGVLVAEKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKLSNTDTETYTYKPTDNGLGCILSTVTGYVCNVSYIGRTKVQAFTFVLGKQVKVELNLKTLKFVK
Ga0181420_1004017103300017757SeawaterMSKLKLNKVELKNVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKEGNQFRVNNSTYQYVEGSENRDNGCIVNSITGHVCNVSYLGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0181420_100780693300017757SeawaterMSKLNKVVLENVVVEKKVDNRTNNPGRPVNKQSARYKRLAKQAFYADVNSKFKSGKTFKVSNSEYNYSQPSNNNEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181420_106169923300017757SeawaterMTKTKNQPTLNKVIVDVVTEAKVDKRTNNPGRPVNKKSARYKRLAKQAFYANVNEKFKSGNTFKVSNAEYNYSQPSNNNEYGCIVNNITGHVCNISYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181420_106304513300017757SeawaterMSKIKLNKVELKNVKNVGVLVAEKVDNRKNNPGRPVNKKSARYIRLQKQAFYANVNDRFKKGNQFEINGQKYNYKHNNTGELGCIVNDISGYVCNVSYIGRTKVQGYSFVLGKKVSIELNLKTLKFVS
Ga0181420_118993513300017757SeawaterMSKLNKVTLDVVVEKKVDNRTNNPGRPVNKKSARYKRLAKQAFYASVNSKFTQGDKFRLEKDQQTYKYMANAGESFGCIVNAITGHVCNVDYIGRTKVTGYTFVLGRKVNVQLNLKTLKFIK
Ga0181420_124441513300017757SeawaterMSVKTKNQSVKLNKVELTNLPNVGVLKVGKTTHTVDRRKNNPGRPVNKKSARYKRLAKQKFYASVNSKFVKGNQFKVNASTYQYSEGNNNELGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181408_107925413300017760SeawaterMSKIKLNKVVLENVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKVNNSTYQYVEGSENRDNGCIVNSITGHVCNVSYLGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181408_113682513300017760SeawaterMSKIKLNKVVLENVKNVGVLVVEKKVDKRTNNPGRPVNKQSARYKRLAKQAFYANVNNKFKSGNKFKINASTYTYSPSNDGLGCIVNDVTGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0181408_114531613300017760SeawaterDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKLSNTDTETYTYKPTDNGLGCILSTVTGYVCNVSYIGRTKVQAFTFVLGKQVKVELNLKTLKFVK
Ga0181408_115607713300017760SeawaterNDVPKEDLRHNNPGRPVNQKSARYKRLAKQKFYASVNSKFVKGNQFKVNNETYVYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVQGYTFVLGKQVKVELNLKTLNFVK
Ga0181422_107191413300017762SeawaterMSKVKLNKVVLENVKNVGVLVVEKKGVAGTKDDKRTSNPGRPVNKKSARYKRLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTF
Ga0181385_101046113300017764SeawaterNKVVVEVSNVEKKIDKRKNNPGRPINKKSARYIRLQQQSWYETINAKFVNGNKFTIANNTYSYNAGKDGSLGCIVNQISMHECNLDYIGRTKVQGYTFVLGKKVKVELNLKTLKFVS
Ga0181385_105263333300017764SeawaterMSKLKLNKVELKNVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFKVNNSTYQYVEGSENRDNGCIVNSITGHVCNVSYLGRTKVQAYSFTLGKKVNVELNLKTLKFVS
Ga0181406_110116813300017767SeawaterKTKNQPTLNKVIVDVVTEAKVDKRTNNPGRPVNKKSARYKRLAKQAFYANVNEKFKSGNAFKVSNAEYNYSQPSNNNEYGCIVNNITGHVCNISYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0187217_110770623300017770SeawaterDNRKNNPGRPVNKKSARYIRLQKQAFYASVNDKFKKGNRFQLDGSSSVYKYSAGDNGLGCIIETAFNTHCANVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0187217_130204213300017770SeawaterMTKLNKVTIEVKKENQPVKVDKCKFNTGRPVNKKSARYKRLAKQAFYSNVNSKFQKGNQFKINNSTYAYSAGKDGKLGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKK
Ga0181386_106630113300017773SeawaterMKVELKNVKNVGVLVVEKKVDKRKNNPGRPVNKKSARYKRLAKQAFYADVNNKFKTGNIFRVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTLKFVS
Ga0181386_106985213300017773SeawaterMTKKTKLNKVVVEVSNVEKKIDKRKNNPGRPINKKSARYIRLQQQSWYETINAKFVNGNKFTIANNTYSYNAGKDGSLGCIVNQISMHECNIDYIGRTKVQGYTFVLGKKVKVELNLKTLKFVS
Ga0181386_107877513300017773SeawaterMSVKTKNQSVKLNKVELTNLPNVGVLKVGKTTHTVDRRKNNPGRPVNKKSARYKRLAKQKFYASVNSKFVKGNQFKVNNETYVYNPSTNGNEYGCILSTITGHVCNVSYIGRTKVQGYTFVLGKQVKVELNLKTLNFVK
Ga0181386_114806513300017773SeawaterMSKVKLNKVELKNVKNVDVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYASVNSKFKEGNQFRVNNSTYQYIEGSENRDNGCIVNSITGHVCNVSYLGRTKVQGYTFVLGKKVNVELNLKTLEFVS
Ga0181432_1002219103300017775SeawaterMTKSKNQAVKLNKVVLNNVDAVVVGVKPAANNDVKPLDGRHNNPGRPVNKKSARYKRLAKQAFYAKVNSKFVKGNQFQLNNTDVEKYVYNPSTNGNEYGCILSTITGHVCNISYIGRTKVQGYSFVLGKKVNVELNLKTLKFVK
Ga0181432_100343963300017775SeawaterMTKSKNQSVKLNKVELTNLPNVGVLVVEKVGVAGTKDDKRTSNPGRPVNKKSARYKRLQKQAFYASVNSKFVKGNQFKLDNTDVETYTYKPSNDSLGCIVNSITGHVCNVSYIGRTKVQGYTFVLGKQVKVELNLKTLVFVSK
Ga0181432_105547933300017775SeawaterIKLNKVELKNVKNVGVLVAEKVSIAGTKNDKRKSNPGRPVNKKSARYKRLAKQAFYADVNSKFQKGNQFKINNSTYAYSAGKDGSLGCIVDGLGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181432_107351513300017775SeawaterGVAGTKDDKRTNNPGRPVNKKSARYIRLKKQAKYARLNSKFVKGNQFKVNQETYIYKPCANDSGTLGSIVSTVTGHVCNVSYIGRTKVQGYTFVLDKKVNVELNLKTLVFVSK
Ga0181432_107500623300017775SeawaterMSKVKLNKVVLENVDAVVVGVKVDKRKNNPGRPVNKQSARYKRLAKQAFYSKVNSKFKKGNQFQLNSTDIEKYTYKPSNDGLGCILSTITGHVCNVSYIGRTKVQGYSFVLGKKVNVE
Ga0181432_108155813300017775SeawaterVELKNVKNVGVLVVEKKGVAGTKVDKRKNNPGRPVNKKSARYIRLQKQAFYSDVNSKFKKGNQFEVNNKTYRYTQGVNNTLGSIFDVSLSSTHACDVTYIGRTKVTGYTSVLGKRVNVELNLKTLKFVK
Ga0181432_116093113300017775SeawaterMTKQTKNQSVKLNKVELTNLPNVGVLKVGVAGTKNDKRTSNPGRPVNKKSARYKRLAKQAFYNDVNSKFVSGKSFKLKNQLTDQQYNYRPSSDGGEYGCILSPIGGHVCNVSYIGRTKVLGYSFV
Ga0181432_120105223300017775SeawaterMSKTKLNKVELKNLPNVGVLVVEKVDNRKNNPGRPVNKQSARYKRLAKQRFYSRVNNKFVSGKSFQLNKESNQQYSYKSNKGEQYGCLISNIGGYVCNVSYIGRTKVTGFTFVLGKKVNVELNLKTVKFVS
Ga0181432_127818813300017775SeawaterRLAKQAFYASVNSKFKKGNQFQLSNTDVEKYAYKSSNDSLGCIISTIGGHVCNVSYIGRTKVQGYSFVLGKKVNVELNLKTLKFVK
Ga0181395_114082513300017779SeawaterMSVKTKNQSVKLNKVELTNLPNVGVLKVGKTTHTVDRRKNNPGRPVNKKSARYKRLAKQKFYASVNSKFVKGNQFKVNNETYVYNPSTNGNEYGCILSTITGHVCNVNYIGRTKVQGYTFVLGKKVNVELNLKTLKFSK
Ga0181423_104918013300017781SeawaterKLNKVVLENVKNVGVLVVEKKVDKRTNNPGRPVNKQSARYKRLAKQAFYTDVNNKFKSGNLFKVNNCTYQYSEGSENRDNGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0211542_105728723300020312MarineMSKIKLNKVEVKVSKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYSNVNSKFKKGNQFEYNNALYKYVAGKNGELGYIATVGIVTQHACNVSYIGRTKVQGYTFVMGKRVGVELNLKTLKFVK
Ga0211532_1035456713300020403MarineMIITNKNQITMTKLNKVTIEVKKENQPAKVDKRKFNTGRPVNKKSARYKRLAKQAFYADVNAKFKKGNQFEYNNALYKYVAGKNGELGHIATVGIVDMHACNVSYIGRTKVQGYTFV
Ga0211587_1030869413300020411MarineMSKVKLNKVEVKVSKVETVKVDKRKNNPGRPVNKKSARYIRLQKQAFYADVNSKFKKGNQFKVDGTSSTYKYSAGKDGSLGCIVETVFNAHVCNVSYVGRTKVKAYSFVMGKKVNVELNLKTLKFVS
Ga0211473_1048624513300020451MarineMTKLNKVTIEVKKENQPTKVDKRKFNTGRPINKKSARYKRLAKQAFYADVNSKFKQGNQFKVNNGVYQYKTHESNLMKDGDLGCIVNTITGYTCNVSYIGRTKVQGFTFVLGKKVNVELNLKTLKFVS
Ga0211643_1055325613300020457MarineMSKIKLNKVEVKVSKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYADVNAKFKQGNQFKINNSTYKYSAGKLDLGCIVDMFTGSHVCNVDYIGRTKVQGYAFVLGKKVNVELNLKTLKFVS
Ga0211640_1037130213300020465MarineVSKVETVKVDNRKNNPGRPVNKKSARYIRLQKQAFYADVNAKFKQGNQFKVNNDVYKYDGKGCIVNTVTGYVCNIDYVGRTKATGYTFVMGKRVNVKINLKQVKFI
Ga0211543_10012983123300020470MarineMIITNKNQITMTKLNKVTIEVKKENQPAKVDKRKFNTGRPVNKQSARYKRLAKQAFYADVNSKFKKGNQFNYNNALYKYVAGKNGELGHISTVGIVDMHACNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0211543_1004695953300020470MarineMSKIKLNKVEVKVSKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYADVNSKFKKGNQFRVNKGDYSTYKYSAGENGGLGCIVSTVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0211543_1015287133300020470MarineMSKIKLNKVEVKVSKVETVKVDKRKNNPGRPVNKKSARYIRLQKQAFYADVNSKFKKGNQFKVDGTSSTYKYSAGKDGSLGCIVETVFNAHVCNVSYVGRTKVKAYSFVMGKKVNVELNLKTLKFVS
Ga0211543_1040804413300020470MarineMSKIKLNKVEVKVSKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYNDVNTKFKKGNQFKVNGSTYAYKHYEGKHIQDGSEYGCIVSTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELN
Ga0209349_105758213300025112MarineMSKIKLNKVELKNVKNVGVLVAEKVSVAGTKNDKRKSNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFRVNKGDYSTYKYSAGKNNELGCIVDTIGGHACNVSYIGRTKVQGYSFVLGKKVNVELNLKTLQFVSKK
Ga0209756_110431223300025141MarineMSKIKLNKVELKNVKNVGVLVAEKVSVAGTKNDKRKSNPGRPVNKKSARYKRLAKQAFYASVNSKFKKGNQFRVNKGDYSTYKYSAGKNNELGCIVDTIGGHACNVSYIGRTKVQGYSFVLGKKVNVELNLKTL
Ga0209645_112193723300025151MarineMSKIKLNKVEVKVNKVETVKVDGRKNNPGRPVNKKSARYIRLQKQAFYADVNSKFQKGNQFKVNNSTYNYSAGKDGKLGCIVDTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0209337_1003647133300025168MarineMSKVKLNKVELKNVKNVGVLVVEKKVDNRKNNPGRPVNKKSARYKRLAKQAFYTDVNNKFKSGNLFKVNNCTYQYSEGSENRDNGCIVNAVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0209337_1006596153300025168MarineMSKIKLNKVVLENVKNVGVLVVEKKVDNRTNNPGRPVNKKSARYKRLAKQAFYNDVNSKFQKENQFQVSNSVYNYSQPGEHSEYGCIVDGITGMHVCNVSYIGRTKVQGFTYVLGKRVNVELNLKTLKFVS
Ga0209337_119840613300025168MarineMSVKLNKVVLENVKNVGVLVVEKKVDNRTNNPGRPVNKQSARYKRLAKQTFYANVNSKFVKGNQFKVSNGQYNYSQPSNNNEYGCIVDAITNMHVCNVSYIGRTKVQGYTYVIG
Ga0256382_105497623300028022SeawaterMSKIKLNKVELKNVKNVGVLVVEKVDKRKNNPGRPVNKKSARYIRLQKQSFYSKVNAKFKKGNQFKINSNVYKYSPSKDGSLGCIVDSIGLHQCNVSYIGRTKVQGYSFVLGKKVNVELNLKTLKFVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.