NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F095761

Metagenome Family F095761

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095761
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 54 residues
Representative Sequence MRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Number of Associated Samples 24
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 77.14 %
% of genes near scaffold ends (potentially truncated) 30.48 %
% of genes from short scaffolds (< 2000 bps) 60.00 %
Associated GOLD sequencing projects 24
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.333 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(59.048 % of family members)
Environment Ontology (ENVO) Unclassified
(99.048 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(86.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.24%    β-sheet: 0.00%    Coil/Unstructured: 54.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF05699Dimer_Tnp_hAT 1.90
PF01582TIR 1.90
PF14223Retrotran_gag_2 0.95
PF13952DUF4216 0.95
PF07714PK_Tyr_Ser-Thr 0.95
PF02519Auxin_inducible 0.95
PF03732Retrotrans_gag 0.95
PF00078RVT_1 0.95
PF06884DUF1264 0.95
PF00067p450 0.95
PF01398JAB 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.81
COG2124Cytochrome P450Defense mechanisms [V] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006177|Ga0075362_10679723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana536Open in IMG/M
3300028786|Ga0307517_10031537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6165Open in IMG/M
3300028786|Ga0307517_10100723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2279Open in IMG/M
3300028786|Ga0307517_10137787All Organisms → Viruses → Predicted Viral1727Open in IMG/M
3300028786|Ga0307517_10366130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana776Open in IMG/M
3300028786|Ga0307517_10568844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana563Open in IMG/M
3300028786|Ga0307517_10582804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana553Open in IMG/M
3300028786|Ga0307517_10609730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana536Open in IMG/M
3300028794|Ga0307515_10035544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae8100Open in IMG/M
3300028794|Ga0307515_10051268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6158Open in IMG/M
3300028794|Ga0307515_10082484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4157Open in IMG/M
3300028794|Ga0307515_10168323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2198Open in IMG/M
3300028794|Ga0307515_10208442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1806Open in IMG/M
3300028794|Ga0307515_10816059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana556Open in IMG/M
3300030521|Ga0307511_10008906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10015Open in IMG/M
3300030521|Ga0307511_10155968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1295Open in IMG/M
3300030521|Ga0307511_10199117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1043Open in IMG/M
3300030521|Ga0307511_10311750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana702Open in IMG/M
3300030521|Ga0307511_10369640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana605Open in IMG/M
3300030521|Ga0307511_10393455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana573Open in IMG/M
3300031456|Ga0307513_10170529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2054Open in IMG/M
3300031456|Ga0307513_10413372All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300031456|Ga0307513_10423709All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300031456|Ga0307513_10446600All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300031456|Ga0307513_10534428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana886Open in IMG/M
3300031456|Ga0307513_10627557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana782Open in IMG/M
3300031456|Ga0307513_10680916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana734Open in IMG/M
3300031507|Ga0307509_10034354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5571Open in IMG/M
3300031507|Ga0307509_10106018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2830Open in IMG/M
3300031507|Ga0307509_10145280All Organisms → Viruses → Predicted Viral2299Open in IMG/M
3300031507|Ga0307509_10223214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1694Open in IMG/M
3300031507|Ga0307509_10418067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1042Open in IMG/M
3300031507|Ga0307509_10626489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana746Open in IMG/M
3300031507|Ga0307509_10638516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana734Open in IMG/M
3300031507|Ga0307509_10767589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana629Open in IMG/M
3300031507|Ga0307509_10809528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana601Open in IMG/M
3300031507|Ga0307509_10861484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana570Open in IMG/M
3300031616|Ga0307508_10311509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1166Open in IMG/M
3300031649|Ga0307514_10033221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4118Open in IMG/M
3300031649|Ga0307514_10063511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2803Open in IMG/M
3300031649|Ga0307514_10200933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1253Open in IMG/M
3300031649|Ga0307514_10301259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba898Open in IMG/M
3300031649|Ga0307514_10455963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus626Open in IMG/M
3300031649|Ga0307514_10480691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana598Open in IMG/M
3300031730|Ga0307516_10088195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2935Open in IMG/M
3300031730|Ga0307516_10189222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1785Open in IMG/M
3300031730|Ga0307516_10238598All Organisms → Viruses → Predicted Viral1517Open in IMG/M
3300031730|Ga0307516_10732262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana647Open in IMG/M
3300031838|Ga0307518_10107699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1988Open in IMG/M
3300031838|Ga0307518_10174220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1462Open in IMG/M
3300031838|Ga0307518_10266261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1074Open in IMG/M
3300031838|Ga0307518_10341617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana878Open in IMG/M
3300031838|Ga0307518_10417806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana737Open in IMG/M
3300031838|Ga0307518_10619561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana510Open in IMG/M
3300032354|Ga0325403_1000456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta28310Open in IMG/M
3300032354|Ga0325403_1016694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6800Open in IMG/M
3300032354|Ga0325403_1018184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6458Open in IMG/M
3300032354|Ga0325403_1020107All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae6053Open in IMG/M
3300032354|Ga0325403_1021526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae5791Open in IMG/M
3300032354|Ga0325403_1077953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1725Open in IMG/M
3300032354|Ga0325403_1082476All Organisms → Viruses → Predicted Viral1593Open in IMG/M
3300032354|Ga0325403_1130753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana789Open in IMG/M
3300032355|Ga0325401_1029056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4887Open in IMG/M
3300032355|Ga0325401_1093957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1691Open in IMG/M
3300032374|Ga0325400_1000043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus68908Open in IMG/M
3300032374|Ga0325400_1113048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1668Open in IMG/M
3300032389|Ga0325405_1032287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3971Open in IMG/M
3300032389|Ga0325405_1047723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2665Open in IMG/M
3300032389|Ga0325405_1089279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1028Open in IMG/M
3300032389|Ga0325405_1094032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana942Open in IMG/M
3300032389|Ga0325405_1108062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana754Open in IMG/M
3300032389|Ga0325405_1130194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana521Open in IMG/M
3300032735|Ga0325410_1030490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4362Open in IMG/M
3300032735|Ga0325410_1055798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2106Open in IMG/M
3300032735|Ga0325410_1127865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana513Open in IMG/M
3300032741|Ga0325414_1039991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3556Open in IMG/M
3300032741|Ga0325414_1087178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1205Open in IMG/M
3300032741|Ga0325414_1111587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus808Open in IMG/M
3300033160|Ga0325402_1001521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus19120Open in IMG/M
3300033179|Ga0307507_10004822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida23206Open in IMG/M
3300033179|Ga0307507_10030257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5713Open in IMG/M
3300033179|Ga0307507_10132226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1947Open in IMG/M
3300033179|Ga0307507_10196836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1403Open in IMG/M
3300033179|Ga0307507_10311073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana956Open in IMG/M
3300033179|Ga0307507_10674443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana520Open in IMG/M
3300033180|Ga0307510_10003181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta19059Open in IMG/M
3300033180|Ga0307510_10508575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana647Open in IMG/M
3300033180|Ga0307510_10583461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana567Open in IMG/M
3300034389|Ga0325419_000368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus47486Open in IMG/M
3300034389|Ga0325419_004288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus15938Open in IMG/M
3300034389|Ga0325419_004682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus15208Open in IMG/M
3300034389|Ga0325419_005507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae13907Open in IMG/M
3300034389|Ga0325419_008821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana10736Open in IMG/M
3300034389|Ga0325419_009200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana10476Open in IMG/M
3300034389|Ga0325419_011395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9096Open in IMG/M
3300034389|Ga0325419_022835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5494Open in IMG/M
3300034389|Ga0325419_027747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4633Open in IMG/M
3300034389|Ga0325419_057609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1998Open in IMG/M
3300034389|Ga0325419_107785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana754Open in IMG/M
3300034688|Ga0325420_008860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana9251Open in IMG/M
3300034688|Ga0325420_127684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana754Open in IMG/M
3300034689|Ga0325421_063762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1807Open in IMG/M
3300034689|Ga0325421_105269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana867Open in IMG/M
3300034778|Ga0325423_007517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11163Open in IMG/M
3300034820|Ga0373959_0002078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3195Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza59.05%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem20.95%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf18.10%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.95%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075362_1067972323300006177Populus EndosphereMRRQVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKRSCCRST*
Ga0307517_1003153713300028786EctomycorrhizaMRQQVQGEEEFLDEAQSRDCVKVVYNKKSLMLLMKTTGEDLSNACKDGKRAVVEAPN
Ga0307517_1010072323300028786EctomycorrhizaMRQQMQGEEEFPDEAQSRDRVKKLYSRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307517_1013778733300028786EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307517_1036613023300028786EctomycorrhizaPVIQRGTEMRQQVQGEEEFPDEAQSRDCVEVVYNIKSLMLLMKTTSEDLSNTYKDGKRAVAEAPD
Ga0307517_1056884423300028786EctomycorrhizaQVQGEEEFPDEAQSRDCVEVVYNMKSLMLLMKTTSEDLSNTYKDGKRVVAEALD
Ga0307517_1058280423300028786EctomycorrhizaVQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0307517_1060973023300028786EctomycorrhizaMRQQVQGEEVFPDEAQSRDCVKSCVQQKSLVLLMKTTGEDLSNACKDGKRAVVEAPN
Ga0307515_1003554433300028794EctomycorrhizaMRQQVQGEEEFPDEAQSRDCYKLYNNKSLVLLMKTTSEDLSNACKDGKRAVAEAPN
Ga0307515_1005126873300028794EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307515_1008248413300028794EctomycorrhizaGTVMRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLMKTTGEDLSNACKDGKRVVAEAPN
Ga0307515_1016832313300028794EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNKKSLVLLIKATSEDLSNACKDGKMSCCRSTKLKGCDRL
Ga0307515_1020844223300028794EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVEVVYNIKSLMLLMKTTSEDLSNTYKDGKRAVAEAPD
Ga0307515_1081605923300028794EctomycorrhizaMRQQVQGEEVFSDEAQSRDCESLYNRKSLMLLMKTTGEDLSNACKDGKRAVAEAPN
Ga0307511_1000890673300030521EctomycorrhizaMRQQVQGEEVFPDEAQSRDCVKVVYNRKPLVLLMKTTSDDLSNAYKDGKMSCCRSTKLRGCDRL
Ga0307511_1015596823300030521EctomycorrhizaMRQQMQGEEKFPDEAQSRDCEKKLYNKKSLVLLIKATSEDLSNACKDGKMRCCRST
Ga0307511_1019911713300030521EctomycorrhizaMRQQVQGEEEFPDKAQSRDCVEVVYNMKSLVLLMKTTSEDLSNTYKDGKMSCCRGTYLRGCKRL
Ga0307511_1031175013300030521EctomycorrhizaVMRQQVQGEEEFPNEAQSRDCVKKLYNRKSLVLLMKTTGEDLSNACKDGKRVVVEAPN
Ga0307511_1036964013300030521EctomycorrhizaSTRRIQRGTVMRQQMQGEEEFSDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307511_1039345513300030521EctomycorrhizaVIQQGTKMRQQVQGEEEFPDEAQSRDCVEVVYNMKSLVLLMKTTSEDLSNTYKDG
Ga0307513_1017052913300031456EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLMKTTGEDLSNACKDGKRVVVEAPN
Ga0307513_1041337233300031456EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0307513_1042370913300031456EctomycorrhizaVIQQGTKIRQQVQGEEEFPDEAQNRDCVEVVYNMKSLVLLMKTTSEDLSNTYKDG
Ga0307513_1044660013300031456EctomycorrhizaEEFPDEAQSRDCVKKLYNKKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0307513_1053442813300031456EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLMKTTGEDLSNACKDGKRVVAEAPN
Ga0307513_1062755713300031456EctomycorrhizaPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307513_1068091613300031456EctomycorrhizaPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCKST
Ga0307509_1003435473300031507EctomycorrhizaMRQQVQGEEVFPDEAQSRDCVKVVYNRKPLVLLMKTTSDDLSNAYKDGKMSCCRSTKLRG
Ga0307509_1010601813300031507EctomycorrhizaMQGEKEFPDEAQSRDCVKNLYNRKSLVLLIKATSEDLSNACKDGKMSSCRST
Ga0307509_1014528043300031507EctomycorrhizaVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRSI
Ga0307509_1022321423300031507EctomycorrhizaVQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRST
Ga0307509_1041806713300031507EctomycorrhizaVQGEEEFPDEAQSRDCVKKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCKST
Ga0307509_1062648913300031507EctomycorrhizaEEVFPDEAQSRDYVKVVYNRKPLVLLMKTTSEDLSNAYKDGKMSCCRSTKLKGCDHL
Ga0307509_1063851623300031507EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKRAVAEAPN
Ga0307509_1076758913300031507EctomycorrhizaVQGEEEFPDEAQSRDYVKKLYNRKSLVLLIKATSEDISNACKDGKMSC
Ga0307509_1080952813300031507EctomycorrhizaTEMRQQVQGEEEFPDEAQSRDCVEVVYNMKSLVLLIKTTSEDLSNTYKDGKRAVAEAPN
Ga0307509_1086148423300031507EctomycorrhizaMRQQMQGEEEFPNEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307508_1031150933300031616EctomycorrhizaMRQQMQGEEEFPDEAQSKDCVKKLYNRKFLVLLIKATSEDLSNACKDGKISCCRST
Ga0307514_1003322153300031649EctomycorrhizaMRQQVQGEEVFPDEAQSRDYVKVVYNRKPLVLLMKTTSEDLSNAYKDGKMSCCRSTKLKGCDHL
Ga0307514_1006351133300031649EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVEVVYNMKSLVLLMKTTSEDFSNTYKDGKRAVAEAPN
Ga0307514_1020093313300031649EctomycorrhizaMRQQVQGEEEFSDEAQSRDYVKKLYNRMSFVLLIKATSEDISNACKDGKMSYCRSTKLKGCDHL
Ga0307514_1030125913300031649EctomycorrhizaEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307514_1045596313300031649EctomycorrhizaEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0307514_1048069113300031649EctomycorrhizaMRQQVQGEEVFPDEAQSRDCVKVVYNRKSLVLLMKTTCEDLSNACKDGNRAVVEAPN
Ga0307516_1008819513300031730EctomycorrhizaMRQQVQGEEEFPDEAHSRDCYRKSLVLLMKTTGEDLSNACKDGKMSCYGST
Ga0307516_1018922223300031730EctomycorrhizaMQGEEEFPDEAQSRDCVKNLYNRKSLVLLIKATSEDLSNACKDGKMSSCRST
Ga0307516_1023859813300031730EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNMKSLVLLIKATSEDFFNACKDGKMSCCKST
Ga0307516_1073226213300031730EctomycorrhizaEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKRAVAEAPN
Ga0307518_1010769913300031838EctomycorrhizaRRIQRGTVMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307518_1017422013300031838EctomycorrhizaVQGEEEFPDEAQSRDCVKKKKLYNRKSLVLLIKATNKDLSNACKDGKMSYCRST
Ga0307518_1026626113300031838EctomycorrhizaEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDRKMSCCRST
Ga0307518_1034161723300031838EctomycorrhizaMRQQMQGEEEFPDEAQSRDRVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0307518_1041780613300031838EctomycorrhizaMRQQMQGEEVFPDEAQSRDCVKKLYNRKSLVLLIKTTGKDLSNACKDGKRAVVEAPN
Ga0307518_1061956123300031838EctomycorrhizaQGEEVFPDEAQSRDCVKVVYNRKPLVLLMKTTSDDLSNAYKDGKMSCCRSTKLRGCDRL
Ga0325403_1000456123300032354XylemMRQQVQGEEEFLDEAQSREEKLYNRKSLVLLMKTTGKDLSNACNDGKRAVVEAPN
Ga0325403_101669433300032354XylemMQEEEEFSDEAQSRDYEKKLYNKKSLVLLIKATSEDLSNACKDGKMSYCRST
Ga0325403_101818453300032354XylemMQGEEEFSDEAQSRDYEKKLYNKKSLVLLIKATSEDLSNACKDGKMSYCRST
Ga0325403_102010713300032354XylemVIQRGTEMRQQVQGKEEFPDKAQSRDCVKVVYNRKSLVLLMKTTSEDLSNACKDGKRAVAKAPN
Ga0325403_102152663300032354XylemMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCYRST
Ga0325403_107795323300032354XylemVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSYCRST
Ga0325403_108247623300032354XylemMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRST
Ga0325403_113075313300032354XylemFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0325401_102905653300032355XylemMRQQVQREEKFSDETQSRDYVKVVYNRKSLVLLIKSTCEDLSNACKDEKMSYCRGT
Ga0325401_109395713300032355XylemDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRST
Ga0325400_1000043263300032374XylemMRQQVQEVFPEEAQSRDIEKLYNSKSLVLLMKTTSEDLFNACKDGKRAFAEALN
Ga0325400_111304813300032374XylemMRQQMQGEEEFPDEAHSRDCVKKLYNRKSLVLLIKSTSEDIFNACKDGKMSCCR
Ga0325405_103228713300032389XylemMQEEEEFSDEAQSKDYEKKLYNKKSLVLLIKATSEDLSNACKDGKMSYCRST
Ga0325405_104772353300032389XylemVQREEEFLDEAQSRDYVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRST
Ga0325405_108927923300032389XylemVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACND
Ga0325405_109403213300032389XylemVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0325405_110806213300032389XylemVIQRGTEMRQQVQGKEEFPDKAQSRDCVKVMYNRKSLVLLMKTTSEDLSNACKDGKRAVAKAPN
Ga0325405_113019423300032389XylemGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0325410_103049043300032735XylemVQGEEEFPDEVQSRDCVKKLYNKKSLVLLIKATSEDLSNACKDGKISCCRST
Ga0325410_105579833300032735XylemMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKISCCRNT
Ga0325410_112786513300032735XylemEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0325414_103999183300032741LeafMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKM
Ga0325414_108717813300032741LeafVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSCCRST
Ga0325414_111158733300032741LeafFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCYRST
Ga0325402_1001521193300033160XylemVQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKVTSEDISNACKDGKMSCCRST
Ga0307507_1000482253300033179EctomycorrhizaMRQQVQGEEEFPNEAQSRDCVEVVYNMKSLVLLMKTISEDLSNTYKNGKRVIAEAPN
Ga0307507_1003025733300033179EctomycorrhizaMRQQVQGEEVFPDEAQSRDCVKVVYNRKPLVLLMKTTSDDLSNAYKDGKMSYCRSTKLRGCDRL
Ga0307507_1013222623300033179EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVEVVYNMKSLVLLMKTTSEDLSNTYKDGKRAVAEAPN
Ga0307507_1019683623300033179EctomycorrhizaMRQQVQGEEEFPDEAQSRDCVKKLYNRKSLVLLMKTTGEDLSNACKDGKRVVVE
Ga0307507_1031107313300033179EctomycorrhizaVQGEEVFPDEAQSRDCEKLYNRKSLMLLMKTTGEDLSNACKDGKRAVAEAPN
Ga0307507_1067444313300033179EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCCR
Ga0307510_10003181183300033180EctomycorrhizaVQGEEVFPDEAQSRDYVKVVYNMKSHVLLMKTTGEDLSNACKDGKISYCTGT
Ga0307510_1050857523300033180EctomycorrhizaMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0307510_1058346113300033180EctomycorrhizaMRQQMQGEEEFPDEAQSRDCVKKLYNKKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0325419_000368_15247_154053300034389LeafMQGEEEFPDVAQSRDCVKKLYNRKSLVLLIKATSEDLSNACKDGKMSCYRST
Ga0325419_004288_7656_78263300034389LeafMRQQVQGEEVFPDEAQSRDCVKRMYHRKSLVLLMKTTGEDLSNACKDGKMSCCRST
Ga0325419_004682_4503_46763300034389LeafMRQQVQGEEEFSDEAQSRDCVKVVYNKKSFVLLIKTTGEDLSNACKDGKRVVVEAPI
Ga0325419_005507_2319_24923300034389LeafMRQQVQGEEVFPDEAQSRDCVKSCVQQKSLVLLMKTTGEDLSNACKDGKRVVVEAPN
Ga0325419_008821_6347_65203300034389LeafMRQQVQGEEVFPDEAQSRDCVKVVYNRKSLVLLMKATCKDLSNACKDEKRAVVEAPN
Ga0325419_009200_8889_90593300034389LeafMRQQMQGEEEFPDEAQSRDCVKKLYNRKSLVLLIKAISEDLSNACKDGKISCCRNT
Ga0325419_011395_6554_67123300034389LeafVQREEEFLDEVQSRDCVKKLYNKKFLVLLIKATSEDLSNACKDGKMSCCRST
Ga0325419_022835_2791_29613300034389LeafMRQQMQGEEEFPDEAHSRDCVKKLYNRKSLVLLIKSTSEDIFNACKDGKMSCCRST
Ga0325419_027747_2240_24103300034389LeafMRQQMQGEEEFLDEAQSRDYVKKLYNRKSLVLLIKATSEDLSNAYKDGKMRCCRST
Ga0325419_057609_1852_19983300034389LeafEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMNCCRST
Ga0325419_107785_33_2063300034389LeafMRQQVQGKEEFPDKAQSRDCVKVVYNRKSLVLLMKTTSEDLSNACKDGKRAVAKAPN
Ga0325420_008860_5817_59813300034688LeafMRQQVQEVFPEEAQSRDIEKLYNNKSLMLLMKTTSEDLFNACKDGKRAFAEALN
Ga0325420_127684_33_2063300034688LeafMRQQVQGKEEFPDKAQSRDCVKVMYNRKSLVLLMKTTSEDLSNACKDGKRAVAKAPN
Ga0325421_063762_1495_16533300034689LeafVQGEEEFLDEAQSRDCVKKLYNMKSLVLLIKATSEDLSNACKDGKMSCCRST
Ga0325421_105269_366_5243300034689LeafVQGEEEFLDEAQSRDCVKKLYNRKSLVLLIKATSEDLSNACNDGKMSYCRST
Ga0325423_007517_6489_66623300034778LeafMRQQVQGEEEFSDEAQSRDCVKVVYNKKSFVLLIKTTGEDLSNACKDGKRVVVEAPN
Ga0373959_0002078_984_11423300034820Rhizosphere SoilVQREEEFLDEAQSRDYVKKLYNRKSLVLLIKATSEDLSNACKDGKMSYCRST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.