NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095911

Metagenome / Metatranscriptome Family F095911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095911
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 48 residues
Representative Sequence MSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFA
Number of Associated Samples 92
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.43 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 83.81 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(26.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.619 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.47%    β-sheet: 0.00%    Coil/Unstructured: 57.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF05239PRC 4.76
PF01479S4 2.86
PF02852Pyr_redox_dim 1.90
PF14019DUF4235 1.90
PF12770CHAT 1.90
PF13185GAF_2 1.90
PF02585PIG-L 0.95
PF02567PhzC-PhzF 0.95
PF07228SpoIIE 0.95
PF05977MFS_3 0.95
PF00892EamA 0.95
PF00011HSP20 0.95
PF04655APH_6_hur 0.95
PF02037SAP 0.95
PF03417AAT 0.95
PF00271Helicase_C 0.95
PF03640Lipoprotein_15 0.95
PF00589Phage_integrase 0.95
PF13551HTH_29 0.95
PF01638HxlR 0.95
PF01381HTH_3 0.95
PF00694Aconitase_C 0.95
PF12840HTH_20 0.95
PF08241Methyltransf_11 0.95
PF07730HisKA_3 0.95
PF02861Clp_N 0.95
PF07690MFS_1 0.95
PF00884Sulfatase 0.95
PF01841Transglut_core 0.95
PF13411MerR_1 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.95
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.95
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.95
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.95
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.95
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.95
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.95
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.95
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.95
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.95
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.95
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.95
COG4927Predicted choloylglycine hydrolaseGeneral function prediction only [R] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.38 %
UnclassifiedrootN/A47.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10213104Not Available784Open in IMG/M
3300004479|Ga0062595_100922338Not Available739Open in IMG/M
3300005332|Ga0066388_102325332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia970Open in IMG/M
3300005334|Ga0068869_101987933Not Available522Open in IMG/M
3300005435|Ga0070714_100093627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2635Open in IMG/M
3300005435|Ga0070714_102227132All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005437|Ga0070710_10633693Not Available747Open in IMG/M
3300005455|Ga0070663_101780400Not Available552Open in IMG/M
3300005602|Ga0070762_11092476Not Available549Open in IMG/M
3300005843|Ga0068860_101711560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300006028|Ga0070717_10482170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1120Open in IMG/M
3300006173|Ga0070716_101671262Not Available525Open in IMG/M
3300006176|Ga0070765_101537036Not Available626Open in IMG/M
3300006358|Ga0068871_101080720Not Available750Open in IMG/M
3300006755|Ga0079222_10159895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1295Open in IMG/M
3300006755|Ga0079222_10185326Not Available1232Open in IMG/M
3300006755|Ga0079222_12037179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Humibacter → Humibacter ginsenosidimutans565Open in IMG/M
3300006804|Ga0079221_10110283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae1370Open in IMG/M
3300006806|Ga0079220_10535879Not Available812Open in IMG/M
3300006954|Ga0079219_12475950Not Available504Open in IMG/M
3300009101|Ga0105247_11563581Not Available540Open in IMG/M
3300009545|Ga0105237_10049285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus4234Open in IMG/M
3300010154|Ga0127503_10995225All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010320|Ga0134109_10164507Not Available804Open in IMG/M
3300010371|Ga0134125_11655588Not Available696Open in IMG/M
3300010373|Ga0134128_10071081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3989Open in IMG/M
3300010373|Ga0134128_11530322Not Available734Open in IMG/M
3300010401|Ga0134121_10127890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus2151Open in IMG/M
3300010401|Ga0134121_10244071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba1569Open in IMG/M
3300010401|Ga0134121_11005185Not Available819Open in IMG/M
3300010861|Ga0126349_1143318Not Available570Open in IMG/M
3300010937|Ga0137776_1631845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Humibacter → Humibacter ginsenosidimutans620Open in IMG/M
3300011120|Ga0150983_12199694Not Available578Open in IMG/M
3300011120|Ga0150983_15421418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii531Open in IMG/M
3300012096|Ga0137389_10644475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae910Open in IMG/M
3300012208|Ga0137376_11438758Not Available580Open in IMG/M
3300012356|Ga0137371_10894985All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012683|Ga0137398_10774478Not Available669Open in IMG/M
3300012957|Ga0164303_10215728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba1074Open in IMG/M
3300012987|Ga0164307_10149493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba1535Open in IMG/M
3300013104|Ga0157370_10452501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1180Open in IMG/M
3300013105|Ga0157369_11857356Not Available612Open in IMG/M
3300013296|Ga0157374_11547331Not Available687Open in IMG/M
3300013307|Ga0157372_10193778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba2354Open in IMG/M
3300013307|Ga0157372_13249071Not Available518Open in IMG/M
3300014501|Ga0182024_10147676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3311Open in IMG/M
3300017926|Ga0187807_1257187Not Available573Open in IMG/M
3300017932|Ga0187814_10128125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia942Open in IMG/M
3300017933|Ga0187801_10491967Not Available517Open in IMG/M
3300017972|Ga0187781_11450233Not Available508Open in IMG/M
3300018006|Ga0187804_10336857Not Available661Open in IMG/M
3300021088|Ga0210404_10038014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2200Open in IMG/M
3300021180|Ga0210396_10864639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae772Open in IMG/M
3300021374|Ga0213881_10535174Not Available532Open in IMG/M
3300021404|Ga0210389_10013304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6350Open in IMG/M
3300021406|Ga0210386_11242580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus629Open in IMG/M
3300021420|Ga0210394_11141344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae671Open in IMG/M
3300021474|Ga0210390_10849928Not Available753Open in IMG/M
3300021479|Ga0210410_10668780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae919Open in IMG/M
3300022530|Ga0242658_1180055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300024347|Ga0179591_1068853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3027Open in IMG/M
3300025915|Ga0207693_10072817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2690Open in IMG/M
3300025916|Ga0207663_10354675Not Available1111Open in IMG/M
3300025916|Ga0207663_10736711Not Available782Open in IMG/M
3300025928|Ga0207700_10072823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2651Open in IMG/M
3300025939|Ga0207665_10705189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.36793Open in IMG/M
3300025981|Ga0207640_10496356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba1016Open in IMG/M
3300026142|Ga0207698_10519187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba1162Open in IMG/M
3300026377|Ga0257171_1081820Not Available569Open in IMG/M
3300027066|Ga0208236_1005596Not Available785Open in IMG/M
3300027171|Ga0207947_1017228Not Available526Open in IMG/M
3300027824|Ga0209040_10095263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1694Open in IMG/M
3300027908|Ga0209006_10941187Not Available691Open in IMG/M
3300027908|Ga0209006_11137722All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300028742|Ga0302220_10249276All Organisms → cellular organisms → Bacteria → Terrabacteria group653Open in IMG/M
3300028789|Ga0302232_10653541Not Available516Open in IMG/M
3300028799|Ga0307284_10484415Not Available507Open in IMG/M
3300029943|Ga0311340_10395441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1273Open in IMG/M
3300030013|Ga0302178_10472616Not Available550Open in IMG/M
3300030503|Ga0311370_11998549Not Available579Open in IMG/M
3300030524|Ga0311357_11533523Not Available563Open in IMG/M
3300030580|Ga0311355_10046862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5119Open in IMG/M
3300030580|Ga0311355_10133373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae2699Open in IMG/M
3300030617|Ga0311356_11350058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300030706|Ga0310039_10048189Not Available1897Open in IMG/M
3300030730|Ga0307482_1097514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae799Open in IMG/M
3300030730|Ga0307482_1240633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031226|Ga0307497_10332351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300031708|Ga0310686_108767758All Organisms → cellular organisms → Bacteria → Terrabacteria group1695Open in IMG/M
3300031819|Ga0318568_10657197Not Available652Open in IMG/M
3300031897|Ga0318520_10456361Not Available786Open in IMG/M
3300032008|Ga0318562_10684829Not Available590Open in IMG/M
3300032009|Ga0318563_10788682Not Available509Open in IMG/M
3300032010|Ga0318569_10596507Not Available514Open in IMG/M
3300032160|Ga0311301_12212602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300032180|Ga0307471_103407702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300032782|Ga0335082_10091996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3022Open in IMG/M
3300032783|Ga0335079_12085231Not Available544Open in IMG/M
3300032805|Ga0335078_11822876Not Available660Open in IMG/M
3300032828|Ga0335080_10083246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3549Open in IMG/M
3300032954|Ga0335083_10624158All Organisms → cellular organisms → Bacteria → Terrabacteria group885Open in IMG/M
3300033134|Ga0335073_10015675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10596Open in IMG/M
3300033134|Ga0335073_10276062All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300033158|Ga0335077_10285775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1811Open in IMG/M
3300033290|Ga0318519_10234681Not Available1057Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.29%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.95%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.95%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.95%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027066Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes)EnvironmentalOpen in IMG/M
3300027171Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1021310433300003505Forest SoilMIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLADFSGEELLPLAPGE
Ga0062595_10092233813300004479SoilMSEPGYHDALRILCDDASGDLHRALAAACESVPAWDPVVYLADFAHQMLFPL
Ga0066388_10232533213300005332Tropical Forest SoilVATLTTGATMSTPGFPDALRVLCQDAGGDVHRVLAAACGPVPA
Ga0068869_10198793323300005334Miscanthus RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADF
Ga0070714_10009362713300005435Agricultural SoilMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAGAAEQ
Ga0070714_10222713213300005435Agricultural SoilMSEPGYHDALRILCQDAGGDLHRVLAAACESVPAWDPVVYLADFAHKVLFPLA
Ga0070710_1063369323300005437Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADFAHQMLFPL
Ga0070663_10178040013300005455Corn RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPL
Ga0070762_1109247623300005602SoilMNVPGYPDALRVLREVAGGDLKHMLAAACASIPAWDPAVYLGD
Ga0068860_10171156023300005843Switchgrass RhizosphereMSEPGYHSALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPLA
Ga0070717_1048217013300006028Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFAC
Ga0070716_10167126223300006173Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLA
Ga0070765_10153703633300006176SoilMREPGYSDALRVLRDAAGGDLQHVITAACEPVPAWDPIIYL
Ga0068871_10108072013300006358Miscanthus RhizosphereMSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADF
Ga0079222_1015989513300006755Agricultural SoilMSEPGYHGALRILCDDASGGLHRALAAACESVPAWDPVVYL
Ga0079222_1018532633300006755Agricultural SoilMSEPGYHEALRLLCQDAGVDLHRVLATACEPVPARDP
Ga0079222_1203717913300006755Agricultural SoilMSEPGYHDALRALRQDAGGDLHRVLAAACEPVPAWDPVVYLADFAFRA
Ga0079221_1011028323300006804Agricultural SoilMSEPGYHDALRLLCQDAGADLHRVLAVACEPVPARDPVVY
Ga0079220_1053587913300006806Agricultural SoilMSEPGYPDALRILCHDVGGGLHHALVAACESVPAWDPVVYLADFAHQVLFPLAGD
Ga0079219_1247595023300006954Agricultural SoilMSEPGYHGALRILCDDASGGLHRALAAACESVPAWDPVVYLADFAH
Ga0105247_1156358113300009101Switchgrass RhizosphereMSEPGYHDALRILCHDAGGDLHRALAAACESVPAWDPVV
Ga0105237_1004928553300009545Corn RhizosphereMSEPGYHDALRILCDEAGGGLHRALAAACESVPAWDPVVYLADFAHQMLF
Ga0127503_1099522523300010154SoilMSEPGYHDALRILCHDAGGDLHRALAAACESVPAWDPVVYLADFA
Ga0134109_1016450723300010320Grasslands SoilMSEPGYHEALRLVCQDAGADVHRVLAAACEPVPARDPVVY
Ga0134125_1165558813300010371Terrestrial SoilMHSLGSGAAMSEPGYHDALRLLCHDASGDLHHALAAACESVPAWDPVV
Ga0134128_1007108113300010373Terrestrial SoilMHSLGSGAAMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDP
Ga0134128_1153032213300010373Terrestrial SoilMSEPGYHDALRILCHDAGGDLHHALAAACESVPAWDPVVYLADFAHQMLF
Ga0134121_1012789013300010401Terrestrial SoilMSEPGYQDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHK
Ga0134121_1024407113300010401Terrestrial SoilMGEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFP
Ga0134121_1100518523300010401Terrestrial SoilMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLAGDA
Ga0126349_114331823300010861Boreal Forest SoilMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPASDPVVYLADFACQMLVPLAA
Ga0137776_163184513300010937SedimentMSEPGYHDALRALRHDAGGDLHRVLAAACGPVPAWDPVVYLADFAFRVLFPLTAGATEQQ
Ga0150983_1219969423300011120Forest SoilMREPGYPDALRVLREVTGGDLNQVLAAACEPVPAWDPVVYLADFSGEVCFRWPLR*
Ga0150983_1542141813300011120Forest SoilMREPGYPDALRLLREVTGGDLHHLLAAACAAVPAWDPVVY
Ga0137389_1064447533300012096Vadose Zone SoilMREPGYPDALRVLREITGGDLHQVLAAACEPVPAWDLVVYLADFSGEVLLPLA
Ga0137376_1143875813300012208Vadose Zone SoilMCHLGSEAAMSEPGYHDALGLLCQDAGADLHRVLAAACEPVPARD
Ga0137371_1089498513300012356Vadose Zone SoilMSEPGYHEALRLLCEDAGADLHRVLAAACERVPAQDPVVYL
Ga0137398_1077447823300012683Vadose Zone SoilMSEPGYHDALRLLCQDAGADLHRVLATACEPVPARDPVVYLADFASQVL
Ga0164303_1021572833300012957SoilMSEPGYHDALRILCDDAGGGLHRALVAACESVPALDPVVYLADFAHQMLFPLAGDAAE
Ga0164307_1014949333300012987SoilMGEPGYHDALRILCDDAGGGLHRALVAACESVPAWDP
Ga0157370_1045250113300013104Corn RhizosphereMSEPGYHSALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLV
Ga0157369_1185735623300013105Corn RhizosphereMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARD
Ga0157374_1154733113300013296Miscanthus RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAH
Ga0157372_1019377843300013307Corn RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFP
Ga0157372_1324907113300013307Corn RhizosphereMSEPGYHDALRILCHDAGGDLHRALAAACESVPAW
Ga0182024_1014767653300014501PermafrostMREPGYSAALRVLRDAAGGDLQHVLDAACEPVPAWDPVVYLADFSGSVLYPLAIRVAEE
Ga0187807_125718723300017926Freshwater SedimentMREPGYSDALRVFREVTEGDLHQVLAAACEPVPAWDPVVYLGDFSGEVLLPLAAGVAEEA
Ga0187814_1012812513300017932Freshwater SedimentMGVPDYPGALWILCQDAGGDLHRALAVACEPVPAWDPVVYLADFSRQVLF
Ga0187801_1049196723300017933Freshwater SedimentMGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLADFAHQVLFPLAA
Ga0187781_1145023323300017972Tropical PeatlandMRMPGYPEALGVLSQDAGGDVHRVLAAACEPVPAWDPVVYLADFAHRV
Ga0187804_1033685713300018006Freshwater SedimentMGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLVDFAHQVLFPLAAGTAAAI
Ga0210404_1003801413300021088SoilMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPAVYLADFACQALVPLAVGAAE
Ga0210396_1086463933300021180SoilMREPGYPDALRVLREVTGGDLHQVLAAACAPLPAWDPV
Ga0213881_1053517413300021374Exposed RockMPVPGYPEALRLLCQDAGGEVQRVLAAACASVPAWDPVVYLADFAHRTLFPLTAGL
Ga0210389_10013304103300021404SoilMREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVY
Ga0210386_1124258013300021406SoilMREPGYPDALRVLREVTGGDLHYVLAAACGAVPAWD
Ga0210394_1114134413300021420SoilMREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPV
Ga0210390_1084992833300021474SoilMIQPGYSDALRVLRDAAGGDLHHVIVAACKPIPAWDPIVYLSDFS
Ga0210410_1066878013300021479SoilMREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLGDFSGEVLLPLATGV
Ga0242658_118005523300022530SoilVTEPGYHDALRLLCQDAGADLHRVLAVACEPVPARDPVVYLADFA
Ga0179591_106885343300024347Vadose Zone SoilMSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVVPG
Ga0207693_1007281743300025915Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLA
Ga0207663_1035467523300025916Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAGA
Ga0207663_1073671113300025916Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRILCHDASGDLHHALAAACESVPAWDPVVYLADFAHQMLFPLAGDEA
Ga0207700_1007282313300025928Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFASQVLVPLAAG
Ga0207665_1070518913300025939Corn, Switchgrass And Miscanthus RhizosphereMSEPGYHDALGVLCQDAGADLHRVLAAACAPVPARDPVVYLADFACQVLVPLAA
Ga0207640_1049635633300025981Corn RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQML
Ga0207698_1051918723300026142Corn RhizosphereMSEPGYHDALRILCDDAGGGLHRALAAACESVPAWDPVVYLADFAHQMLFPLAGDAAEQ
Ga0257171_108182013300026377SoilMSEPGYHDALRLLCQDAGADLHRVLAAACEPVPARDPVVYLADFA
Ga0208236_100559633300027066Forest SoilMIEPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLGDFSGEELLP
Ga0207947_101722813300027171Forest SoilMIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLADFSGEELLP
Ga0209040_1009526313300027824Bog Forest SoilMCHLGSGAAMSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVY
Ga0209006_1094118713300027908Forest SoilMIEPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYLG
Ga0209006_1113772223300027908Forest SoilMREPGYSDALRVLRDAAGGDLQHVLDAACEPVPAWDP
Ga0302220_1024927613300028742PalsaMIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPIVYVSDFSGEELI
Ga0302232_1065354113300028789PalsaMRESGYEPGYPHALRVLREAAGGDLQNVLNAACEPIPAWDPVVYL
Ga0307284_1048441523300028799SoilMSEPGYHDALRVLCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPL
Ga0311340_1039544113300029943PalsaMGEPGLYDALRVLREAAGGDLQHVITAACATVPARDPVIYLG
Ga0302178_1047261613300030013PalsaMRESGYSDALRVLRDAAGGDLQHVLDAACEPVPAWNPVVYLADFS
Ga0311370_1199854923300030503PalsaMREPGYSDALRVLRAAAGGDLQHVLDAACEPVPAWDPVVYLADFSGSVLL
Ga0311357_1153352313300030524PalsaMIQPGYSDALRVLRDAAGGDLQHVITAACEPIPAWDPIVYLSDFSGQELIPLA
Ga0311355_1004686283300030580PalsaMHEPAYSDALRVLRDAAGGDLQHVIAAACEPVPAWDPIVYLGDFSGEELLPLTPG
Ga0311355_1013337353300030580PalsaMIQPGYSDALRVLRDAAGGDLQHVIVAACEPIPAWDPI
Ga0311356_1135005823300030617PalsaMRESGYSDALRVLRDAAGGDLQHVLDAACEPVPAWNPVVYLADFSGSVLFPLAVR
Ga0310039_1004818933300030706Peatlands SoilMGVPDYPGALRILCQDAEGDLQRVLAAACEPVPAWDPVVYLADFSGQVLFPLA
Ga0307482_109751433300030730Hardwood Forest SoilMREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLGDFS
Ga0307482_124063323300030730Hardwood Forest SoilMREPGYPDALRVLREVTGGDLQQVLAAACEPVPAWDPVVYLADFSGEVLLPLATGA
Ga0307497_1033235113300031226SoilMSEPGYHDALRILCQDAGADLHRVLAAACEPVPARDPVVYLADFACQVLVPLAA
Ga0310686_10876775813300031708SoilMREPGYSAALRVLRDAAGGDLQQVIAAACEPVPAWDPVVYLG
Ga0318568_1065719723300031819SoilMSEPGYHNALRASCDDAGVDLHRVLTAACEPMPAWDPVVYL
Ga0318520_1045636123300031897SoilMSEPGYRDALRVVCDDAGVDLHRVLTAACEPLPAWDPVVYLA
Ga0318562_1068482913300032008SoilMGQPGYSDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLA
Ga0318563_1078868213300032009SoilMPVPGYPEALRVLCQDAGSDVHRVLAAACAPVPAWDPVVYLADFAYQV
Ga0318569_1059650723300032010SoilMGQPGYSDALGVLRQAAGGDLHRVLAAACAPVPAWDPVIYLADFAHQVLFPLAAGVAEEE
Ga0311301_1221260213300032160Peatlands SoilMGVPGFPEALRVLCHDAGGDLHQVLAAACEPVPAWDPVVYLVDFAHMVLF
Ga0307471_10340770223300032180Hardwood Forest SoilMSEPGYHSALRVLCQDAGADLHRVLAAACEPLSAR
Ga0335082_1009199653300032782SoilMSEPGYREALRVLCDDAAVDLHRVLTAACEPLPAWDPVVYLADFAFQVLFPL
Ga0335079_1208523123300032783SoilMGQPGYPDALEVLRQAAGGDLHRVLAAACAPVPAWDPVIYLVDFAHQVLFPLAAGVAEEE
Ga0335078_1182287613300032805SoilMSEPGYDDALRVLCDDAGVDLHRVLTAACEPLPAWDPVVYLADFAFQVLFPLAA
Ga0335080_1008324613300032828SoilMGVPDYPGALWILCQDAGGDLQRVLAAACEPVPAWDPVVYLADFSRQVLFPLAAGVAAE
Ga0335083_1062415823300032954SoilMSEPGYHDALRALRQDAGGDLHRVLAAACEPVPAWDPVVYLADFAFRVLF
Ga0335073_10015675143300033134SoilMHEPGYSDALRVLRDAAGRDLQHVIAAACAPVPAWDPVV
Ga0335073_1027606213300033134SoilMGQPGYPDALGVLRQAAGGDLHRVLAAACAPVPGWDPVIYLADF
Ga0335077_1028577513300033158SoilMGQPGYPDALGVLRQAAGGDLHRVLAAACGPVPAWDPVIYLADF
Ga0318519_1023468123300033290SoilMSEPGYHDALGVLCRDAGGDPHRVLAAACEPVPAWDPVVYLADFAHQVLCPLAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.