NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095916

Metagenome / Metatranscriptome Family F095916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095916
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 51 residues
Representative Sequence MALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAG
Number of Associated Samples 96
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.05 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.333 % of family members)
Environment Ontology (ENVO) Unclassified
(30.476 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.524 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 60.00%    β-sheet: 0.00%    Coil/Unstructured: 40.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF07963N_methyl 29.52
PF13544Obsolete Pfam Family 6.67
PF01551Peptidase_M23 0.95
PF14584DUF4446 0.95
PF13432TPR_16 0.95
PF08327AHSA1 0.95
PF07228SpoIIE 0.95
PF03793PASTA 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.14 %
UnclassifiedrootN/A2.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000041|ARcpr5oldR_c006204All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300000044|ARSoilOldRDRAFT_c011677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300000443|F12B_10416896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300000891|JGI10214J12806_10064202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300000891|JGI10214J12806_13851122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300000956|JGI10216J12902_101077298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300000956|JGI10216J12902_109538618All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1400Open in IMG/M
3300000956|JGI10216J12902_116660194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300002568|C688J35102_118669382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300004081|Ga0063454_100137298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300004081|Ga0063454_100619436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300004114|Ga0062593_101144755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300005093|Ga0062594_101253485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300005172|Ga0066683_10233561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1139Open in IMG/M
3300005294|Ga0065705_10482496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300005337|Ga0070682_100788173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300005355|Ga0070671_101731753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300005364|Ga0070673_100874202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300005406|Ga0070703_10046545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1371Open in IMG/M
3300005435|Ga0070714_101062878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300005437|Ga0070710_11169031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300005438|Ga0070701_10055019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2077Open in IMG/M
3300005441|Ga0070700_101371220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300005468|Ga0070707_100870699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300005526|Ga0073909_10006223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3532Open in IMG/M
3300005526|Ga0073909_10043859All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300005526|Ga0073909_10611042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300005540|Ga0066697_10126365All Organisms → cellular organisms → Bacteria → Proteobacteria1502Open in IMG/M
3300005544|Ga0070686_100262880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1266Open in IMG/M
3300005561|Ga0066699_10783057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300005563|Ga0068855_100728887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1059Open in IMG/M
3300005719|Ga0068861_100041189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3459Open in IMG/M
3300005843|Ga0068860_101277008All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300006173|Ga0070716_101352000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300006358|Ga0068871_102007741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300006755|Ga0079222_11959726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300006806|Ga0079220_11693167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300006844|Ga0075428_101155224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300006845|Ga0075421_101420621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300006881|Ga0068865_100423081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1096Open in IMG/M
3300006903|Ga0075426_10199949All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300006914|Ga0075436_100860112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300009093|Ga0105240_11578059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300009094|Ga0111539_13490528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300009148|Ga0105243_12982746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300009156|Ga0111538_11776941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300009177|Ga0105248_10707792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1136Open in IMG/M
3300010043|Ga0126380_11214952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300010337|Ga0134062_10731302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300010366|Ga0126379_11243810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium851Open in IMG/M
3300010373|Ga0134128_10552932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1282Open in IMG/M
3300010400|Ga0134122_10092108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2387Open in IMG/M
3300010401|Ga0134121_10191181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1766Open in IMG/M
3300012487|Ga0157321_1007073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300012490|Ga0157322_1001847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1119Open in IMG/M
3300012495|Ga0157323_1011504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300012497|Ga0157319_1054564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012896|Ga0157303_10006216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1675Open in IMG/M
3300012900|Ga0157292_10178467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300012907|Ga0157283_10036182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1050Open in IMG/M
3300012971|Ga0126369_13009534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012984|Ga0164309_10023212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3289Open in IMG/M
3300012987|Ga0164307_10824896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300012988|Ga0164306_11657950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300013102|Ga0157371_10941447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300013296|Ga0157374_12373565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300013297|Ga0157378_11251515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300013306|Ga0163162_13152565Not Available529Open in IMG/M
3300015077|Ga0173483_10400079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300015372|Ga0132256_101364642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300018031|Ga0184634_10411592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300018067|Ga0184611_1250017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300018431|Ga0066655_10822870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300019269|Ga0184644_1560497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300022883|Ga0247786_1159262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300022898|Ga0247745_1029188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300023072|Ga0247799_1083318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300023263|Ga0247800_1060315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300025901|Ga0207688_10366402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → unclassified Caulobacteraceae → Caulobacteraceae bacterium890Open in IMG/M
3300025913|Ga0207695_11288295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300025915|Ga0207693_10722476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300025915|Ga0207693_11253212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300025915|Ga0207693_11271707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300025941|Ga0207711_10559314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1067Open in IMG/M
3300025942|Ga0207689_11137767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300025949|Ga0207667_11450029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300025960|Ga0207651_11279369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300025960|Ga0207651_12077679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300026067|Ga0207678_10645325Not Available930Open in IMG/M
3300026078|Ga0207702_10962008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300026116|Ga0207674_11260939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300026118|Ga0207675_100626398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1080Open in IMG/M
3300026121|Ga0207683_10548017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1069Open in IMG/M
3300026547|Ga0209156_10251893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300026550|Ga0209474_10314817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300028145|Ga0247663_1049078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300028707|Ga0307291_1135928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300028721|Ga0307315_10115502Not Available798Open in IMG/M
3300028755|Ga0307316_10373060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300028784|Ga0307282_10170858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1034Open in IMG/M
3300028814|Ga0307302_10064888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1713Open in IMG/M
3300028875|Ga0307289_10114172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1105Open in IMG/M
3300031198|Ga0307500_10062679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300032174|Ga0307470_10183475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1319Open in IMG/M
3300033551|Ga0247830_10692441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ARcpr5oldR_00620433300000041Arabidopsis RhizosphereMRLVQSERGMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEAGINNSMA
ARSoilOldRDRAFT_01167723300000044Arabidopsis RhizosphereMRLVQSERGMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEAGINNS
F12B_1041689613300000443SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGVNNSMAVLNLPTN
JGI10214J12806_1006420233300000891SoilMALVMAIGITSVLGIAGATAIAYSTSGAQEARQSG
JGI10214J12806_1385112223300000891SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGMNNSMAVLNLPTNNA
JGI10216J12902_10107729813300000956SoilMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEAG
JGI10216J12902_10953861813300000956SoilMRLVQSERGMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEAG
JGI10216J12902_11666019423300000956SoilMALVMAIGITSVLGIAGTTAMVYTSSAAQESQQSSSRQSAFTLAEAGINNVMSILN
C688J35102_11866938223300002568SoilMALVMAIGITSVLGIAGATAVAYSTSGAQEAQQSGSRQGAFSL
Ga0063454_10013729813300004081SoilMALVMAVGITAVLLISGTTAIAYSTSGSKQSAQSRSRQSAFSLAESGVN
Ga0063454_10061943623300004081SoilMALIMAIGITSVLGIAGATAVAYSTSGAQEAQQSGSRQSAFTLAESGINNVMSVLNLPTNNALD
Ga0062593_10114475513300004114SoilMRLVQSERGMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYA
Ga0062594_10125348513300005093SoilMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEAGINNAMSVLNLPTNNAL
Ga0066683_1023356113300005172SoilMALVMAIGITTVLAIAGTTSMVYTTSNSTESIQTSSRSSAFDLAES
Ga0065705_1048249613300005294Switchgrass RhizosphereVRVVKCERGIALVMAIGITTVLAIAGTTAIAYSTSSTTESSQTYSRQSAFS
Ga0070682_10078817313300005337Corn RhizosphereMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEAGINNAMS
Ga0070671_10173175323300005355Switchgrass RhizosphereMRLRLRGERGMALVMAIGIMAVLSIAGTTAVMYSTSSAQQATQSRSRSDAFSLAE
Ga0070673_10087420213300005364Switchgrass RhizosphereMRRRWPGRRVRVESERGIALVMAIGIMAVLGIVGVTVASYSTSATTESNQTQARTSAFALAEGGINNIMAILDLPTNN
Ga0070703_1004654513300005406Corn, Switchgrass And Miscanthus RhizosphereMALIMAIGITSVLGIAGATAVAYSTSGAQQAQQSGSRQNAFTL
Ga0070714_10106287813300005435Agricultural SoilVRVESERGIALVMAIGIMAVLGIVGVTVASYSTSATTESNQTQARTSAFALAEGGINNIMAILD
Ga0070710_1116903123300005437Corn, Switchgrass And Miscanthus RhizosphereMALVMAIGIMAVLGIVGVTVASYSASATTESNQTQARTSAFALAEGGINNIMAIL
Ga0070701_1005501913300005438Corn, Switchgrass And Miscanthus RhizosphereMALIMAIGITSVLGIAGATAVAYSTSGAQQAQQSGSRQNAFT
Ga0070700_10137122013300005441Corn, Switchgrass And Miscanthus RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQSAFSLAEGGINNIMSILN
Ga0070707_10087069913300005468Corn, Switchgrass And Miscanthus RhizosphereMALVMALGMTVVLGIAGTTAIAYSTSSSTQAVQSRSRGNAFSLAEAGIN
Ga0073909_1000622353300005526Surface SoilMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNAFSLAEAGINNSMAVLNLPTNNALDAD
Ga0073909_1004385923300005526Surface SoilMALVMAIGIMAVLSIAGTTAVMYSTSSAQQATQSRSRSDAFSLAEA
Ga0073909_1061104223300005526Surface SoilMALVMAIGIMSVLGIAGATAMAYSTSGAQQAQQSGSRQNAFSLSEAGVNN
Ga0066697_1012636513300005540SoilMALVMALGMTVVLGMAGTTAMVYSTSNSTEAYQTRSRGNAFSLAESGINNSMAILDLPTN
Ga0070686_10026288033300005544Switchgrass RhizosphereMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNAFSLAEAGINNS
Ga0066699_1078305713300005561SoilMALVMTIGITTVLGIAGTTAMVYSTSNSTESIQSSSRQDAFSLAEAGINNAMAVLNLPTN
Ga0068855_10072888713300005563Corn RhizosphereMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNAFSLAEA
Ga0068861_10004118953300005719Switchgrass RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQ
Ga0068860_10127700823300005843Switchgrass RhizosphereMAIGITTVLAIAGTTAIAYSTSSSTQSTQTRSRSDAFTLAEAGINNVMAV
Ga0070716_10135200013300006173Corn, Switchgrass And Miscanthus RhizosphereMALVMAIGIMAVLGIVGVTVASYSASATTESNQTQARTSAFALAEGGINNIMAILDLP
Ga0068871_10200774123300006358Miscanthus RhizosphereMALVMAIGIMAVLGIVGVTVASYSASATTESNQTQARTSAFALAEGGINNIMAILD
Ga0079222_1195972613300006755Agricultural SoilMALVMAIGITSVLGIAGTTAMVYTSSAAQESQQSSSRQNA
Ga0079220_1169316723300006806Agricultural SoilMALVMAIGITSVLGIAGTTAMVYTSSAAQESQQSSSRQSAFTLAEAGINNVMSI
Ga0075428_10115522423300006844Populus RhizosphereMALVMAIGITTVLAIAGTTAIAYSTSSSTQSTQTRSRIDAFTLAEAGINNVMAVLNLPTNNA
Ga0075421_10142062113300006845Populus RhizosphereMALIMAIGITSVLGIAGATAVAYSTSGAQEAQQSGSRQS
Ga0068865_10042308133300006881Miscanthus RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQSAFSLAEG
Ga0075426_1019994913300006903Populus RhizosphereMRLRLRGERGMALVMAIGIMAVLSIAGTTAVMYSTSSAQQATQSRSRSDAFSLAEAGINNAM
Ga0075436_10086011213300006914Populus RhizosphereMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEAGINNAMSVLNLPTN
Ga0105240_1157805923300009093Corn RhizosphereMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNA
Ga0111539_1349052823300009094Populus RhizosphereMALVMAIGITTVLAIAGTTAIAYSTSSSTQSTQTRSRIDAFTLAEA
Ga0105243_1298274613300009148Miscanthus RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQSAFSLAEGGINNIMSILNLPTNNA
Ga0111538_1177694123300009156Populus RhizosphereMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLA
Ga0105248_1070779233300009177Switchgrass RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQSAFSLAE
Ga0126380_1121495213300010043Tropical Forest SoilMAIGIMAVLGIVGTTVMAYSTSATTESNQTGARTSAFALAEGGINN
Ga0134062_1073130223300010337Grasslands SoilMALVMAIGITTVLAIAGTTSMVYTTSNSTESIQTSSRSSAFDL
Ga0126379_1124381023300010366Tropical Forest SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSR
Ga0134128_1055293223300010373Terrestrial SoilMALIMAIGITSVLGIAGATAVAYSTSGAQQAQQSGSRQNAFTLSEAGVNNAMAVLNLPTNNALD
Ga0134122_1009210813300010400Terrestrial SoilMALVMAIGITSVLGIAGATAVAYSTSGAQASQQSGARQNAFSLAEA
Ga0134121_1019118143300010401Terrestrial SoilMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQ
Ga0157321_100707323300012487Arabidopsis RhizosphereMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSTQTRSRTSAFSLAEAGVN
Ga0157322_100184733300012490Arabidopsis RhizosphereMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEAGINNSMAVLNLPT
Ga0157323_101150413300012495Arabidopsis RhizosphereMALVMAIGITTVLAIAGTTAIAYSTSSERQSTQTRSRLTAYALAEA
Ga0157319_105456423300012497Arabidopsis RhizosphereMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSTQTRSRTSAFALA
Ga0157303_1000621633300012896SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGVN
Ga0157292_1017846713300012900SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGVNNS
Ga0157283_1003618233300012907SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQKRSSTSAFSLAEAGV
Ga0126369_1300953423300012971Tropical Forest SoilMAIGIMAVLGIVGTTVMAYSTSATTESNQTGARTSAFALAEGGINNIMSILDLPTNN
Ga0164309_1002321213300012984SoilMALVMAIGITSVLGIAGTTAIAYSTSGAQESQQSGARQN
Ga0164307_1082489623300012987SoilMALIMAIGITSVLGIAGATAVAYSTSGAQEAQQSGSRQNAFSLAEAG
Ga0164306_1165795023300012988SoilMALVMAIGITSVLGIAGTTAIAYSTSASTQSSQAHSRQSAFSLAEAGINNSM
Ga0157371_1094144713300013102Corn RhizosphereMALVMAIGITSVLGIAGATAVAYSTSGTQESQQSGARQNAF
Ga0157374_1237356513300013296Miscanthus RhizosphereMALVMAIGIMTVLAIAGTTAVVYSTSSAQEATQTRTRQSAFSLAEAGINNAMA
Ga0157378_1125151513300013297Miscanthus RhizosphereMALIMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNAFS
Ga0163162_1315256513300013306Switchgrass RhizosphereMALVMAIGITSVLGIAGATAVAYSTSGAQESQQSGARQNAFSLAEAGINNSMAVLNLPTNNALDADTLNK
Ga0173483_1040007933300015077SoilMALVMAIGIMAVLGIVGATVASYSTSATTESNQTQARTSAFALAEGGIN
Ga0132256_10136464213300015372Arabidopsis RhizosphereMALVMAIGIMTVLAIAGTTAIAYSTSSAEQSTQTRSRQSAFSLAEAGVNNSMAV
Ga0184634_1041159223300018031Groundwater SedimentVRLVKCERGIALVMAIGITTVLAIAGTTAIAYSTSSSTQSTQTRSRSDAFTLAEAGINNVMAVL
Ga0184611_125001723300018067Groundwater SedimentVRLVKCERGIALVMAIGITTVLAIAGTTAIAYSTSSSTQSTQTRSRSDAFTLAEAGIN
Ga0066655_1082287013300018431Grasslands SoilMALVMALGMTVVLGMAGTTAMVYSTSNSTQAYQTRSRGNAFSLA
Ga0184644_156049713300019269Groundwater SedimentMALVLAIGITTVLAIAGTTAIAYSTSSATQATQSRARQSTFSLAEAGMSNAMSVLNLPTN
Ga0247786_115926213300022883SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGMNNS
Ga0247745_102918813300022898SoilMALVMAIGIMAVLGIVGATVASYSTSATTESNQTQARTSAFALAEGGINN
Ga0247799_108331813300023072SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRT
Ga0247800_106031513300023263SoilMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAG
Ga0207688_1036640213300025901Corn, Switchgrass And Miscanthus RhizosphereMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEAGINNAMSV
Ga0207695_1128829513300025913Corn RhizosphereMALIMAIGITSVLGIAGATAVAYSTSGAQQAQQSGSRQ
Ga0207693_1072247613300025915Corn, Switchgrass And Miscanthus RhizosphereVRVESERGIALVMAIGIMAVLGIVGVTVASYSTSATTESNQTQARTSAFALAEGGINNIMAILDL
Ga0207693_1125321213300025915Corn, Switchgrass And Miscanthus RhizosphereVRVESERGIALVMAIGIMAVLGIVGVTVASYSTSATTESNQTQARTSAFALAEGGINNIMAILDLPT
Ga0207693_1127170713300025915Corn, Switchgrass And Miscanthus RhizosphereMALVMAIGIMAVLGIVGVTVASYSASATTESNQTQARTSAFALAEGGINNIMAILDL
Ga0207711_1055931413300025941Switchgrass RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQS
Ga0207689_1113776723300025942Miscanthus RhizosphereMALVMAIGITSVLGIAGTTAMVYTSSAAQESQQSSSRQSAFTL
Ga0207667_1145002913300025949Corn RhizosphereMALVMAIGIMTVLAIAGTTAIAYSTSSAQQSAQTRSRTSAFSLAEAGVNN
Ga0207651_1127936923300025960Switchgrass RhizosphereMRRRWPGRRVRVESERGIALVMAIGIMAVLGIVGVTVASYSTSATTESNQTQARTSAFALAEGGINNIMAILDLPTNNA
Ga0207651_1207767923300025960Switchgrass RhizosphereMALVMAIGITSVLGIAGTTAMVYTSSAAQESQQSSS
Ga0207678_1064532513300026067Corn RhizosphereMALVMAIGIMAVLGIAGTTAVAYSTSATTESSQTQSRASAFSLAEAGINNVMSILDLP
Ga0207702_1096200823300026078Corn RhizosphereMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEAGI
Ga0207674_1126093913300026116Corn RhizosphereMALVMAIGITSVLGIAGTTAMVYTNSAAQESQQSSSRQNAFSLAEA
Ga0207675_10062639813300026118Switchgrass RhizosphereMALVMAIGIMTVLAIAGTTAVVYSTSSAQEATQTRTRQSAFSLAEAGINNAMAVLNLPTN
Ga0207683_1054801713300026121Miscanthus RhizosphereMALVMAIGIMSVLGIAGTTAIAYSTSASTQSSQAQSRQSA
Ga0209156_1025189323300026547SoilMALVMALGMTVVLGIAGTTAMVYSTSNSTQAYQSRSRGNAFS
Ga0209474_1031481713300026550SoilMALVMALGMTVVLGIAGTTAMAYSTSNSTQAYQSRSRGNAFSLAESGINNSMAILDLP
Ga0247663_104907823300028145SoilVRVESERGIALVMAIGIMAVLSIAGTTAVMYSTSSAQQASQSRSRSNAFSLAWDDS
Ga0307291_113592823300028707SoilMALVMAIGIMSVLGIAGTTALAYSTSASTQSSQAQSRQSA
Ga0307315_1011550213300028721SoilMALVLAIGITTVLAIAGTTAIAYSTSSATQATQSRARQ
Ga0307316_1037306013300028755SoilMALVMAIGITSVLAIAGTTALAYSTSGAQEAQQSGSRQNAFTLAEAGINNAMAVLNLPTNNALDADTLNK
Ga0307282_1017085813300028784SoilMALVLAIGITTVLAIAGTTAIAYSTSSATQATQSRARQSTFSLAEAGM
Ga0307302_1006488813300028814SoilMALVLAIGITTVLAIAGTTAIAYSTSSATQATQSRA
Ga0307289_1011417213300028875SoilMALIMAIGITSVLGIAGATAITYSTSGAQESQQSSSRQSAFSLAEAGINNVMSILNLPTNNAL
Ga0307500_1006267913300031198SoilMALVMAIGITSVLGIAGTTAIAYSTSGAQEAQQSGSRQSAFTLAE
Ga0307470_1018347513300032174Hardwood Forest SoilMALVMAIGIMTVLAIAGTTAVVYSPSSAQEATQTRT
Ga0247830_1069244113300033551SoilMALVMAIGIMTVLAIAGTTAVVYSTSSAQEATQTRTRQSAYSRAETGINKAK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.