NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096134

Metagenome / Metatranscriptome Family F096134

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096134
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 49 residues
Representative Sequence MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER
Number of Associated Samples 96
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.29 %
% of genes near scaffold ends (potentially truncated) 55.24 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(19.048 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.571 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 88.00%    β-sheet: 0.00%    Coil/Unstructured: 12.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF11752DUF3309 3.81
PF05532CsbD 2.86
PF08281Sigma70_r4_2 2.86
PF00106adh_short 1.90
PF14347DUF4399 1.90
PF00916Sulfate_transp 1.90
PF13358DDE_3 1.90
PF00005ABC_tran 1.90
PF04542Sigma70_r2 1.90
PF00664ABC_membrane 0.95
PF07883Cupin_2 0.95
PF00313CSD 0.95
PF13384HTH_23 0.95
PF00392GntR 0.95
PF01710HTH_Tnp_IS630 0.95
PF09361Phasin_2 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 2.86
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.90
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 1.90
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.90
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.90
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 1.90
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 1.90
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.90
COG3415CRISPR-associated protein Csa3, CARF domainDefense mechanisms [V] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.14 %
UnclassifiedrootN/A2.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17412194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2680Open in IMG/M
2166559005|cont_contig68276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
2170459009|GA8DASG02JO9LVNot Available522Open in IMG/M
3300000787|JGI11643J11755_11757868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300002245|JGIcombinedJ26739_101034092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium707Open in IMG/M
3300002911|JGI25390J43892_10043256All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300002914|JGI25617J43924_10005116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3966Open in IMG/M
3300004463|Ga0063356_103817852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300004643|Ga0062591_102294674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300005147|Ga0066821_1011256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300005163|Ga0066823_10019296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1046Open in IMG/M
3300005177|Ga0066690_11060477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300005181|Ga0066678_10186594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1318Open in IMG/M
3300005347|Ga0070668_100662059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300005434|Ga0070709_10094270All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300005436|Ga0070713_100367615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1337Open in IMG/M
3300005437|Ga0070710_10037746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2650Open in IMG/M
3300005439|Ga0070711_100816611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300005440|Ga0070705_100342768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1087Open in IMG/M
3300005444|Ga0070694_100053698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2728Open in IMG/M
3300005468|Ga0070707_100130461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2444Open in IMG/M
3300005471|Ga0070698_100837553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium864Open in IMG/M
3300005536|Ga0070697_101654003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300005546|Ga0070696_101939486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300005557|Ga0066704_10728840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300005598|Ga0066706_10292300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1280Open in IMG/M
3300006028|Ga0070717_10789998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300006042|Ga0075368_10509031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300006058|Ga0075432_10550919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300006163|Ga0070715_10159436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1114Open in IMG/M
3300006172|Ga0075018_10245271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium865Open in IMG/M
3300006173|Ga0070716_100203863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1317Open in IMG/M
3300006175|Ga0070712_100295928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1308Open in IMG/M
3300006603|Ga0074064_11753837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1162Open in IMG/M
3300006845|Ga0075421_100810948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1077Open in IMG/M
3300006852|Ga0075433_11654710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300006854|Ga0075425_101337774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300006854|Ga0075425_102237354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300006871|Ga0075434_102326849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300006904|Ga0075424_101305299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium772Open in IMG/M
3300007076|Ga0075435_101383907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300007076|Ga0075435_101942502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300009038|Ga0099829_10306705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1302Open in IMG/M
3300009101|Ga0105247_11847563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300009137|Ga0066709_103147405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300009156|Ga0111538_12041754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300009162|Ga0075423_10849290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium967Open in IMG/M
3300009553|Ga0105249_10701618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1072Open in IMG/M
3300010154|Ga0127503_10073639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1074Open in IMG/M
3300010304|Ga0134088_10082280All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300010371|Ga0134125_12837814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300010403|Ga0134123_12916792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300011120|Ga0150983_10151831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium894Open in IMG/M
3300011120|Ga0150983_13510750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium831Open in IMG/M
3300011269|Ga0137392_10951591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300012180|Ga0153974_1096434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300012198|Ga0137364_10620786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300012206|Ga0137380_10837169All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012212|Ga0150985_116199113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300012356|Ga0137371_11007462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300012361|Ga0137360_10238142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1489Open in IMG/M
3300012683|Ga0137398_10192422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1342Open in IMG/M
3300012923|Ga0137359_10174554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1919Open in IMG/M
3300012923|Ga0137359_11185071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300012924|Ga0137413_11702217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300012938|Ga0162651_100027535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300012957|Ga0164303_10268612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium988Open in IMG/M
3300012960|Ga0164301_10369446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium993Open in IMG/M
3300012985|Ga0164308_11702973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium585Open in IMG/M
3300012986|Ga0164304_11773009Not Available516Open in IMG/M
3300012988|Ga0164306_10731428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300015374|Ga0132255_105065611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300016294|Ga0182041_10604126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300018468|Ga0066662_12095368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300018468|Ga0066662_12421409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300018482|Ga0066669_10804606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium833Open in IMG/M
3300020579|Ga0210407_10426889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1037Open in IMG/M
3300021405|Ga0210387_10083371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2643Open in IMG/M
3300021479|Ga0210410_10184388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1867Open in IMG/M
3300025916|Ga0207663_11094424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300025922|Ga0207646_10311154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1423Open in IMG/M
3300025922|Ga0207646_10344085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1347Open in IMG/M
3300025928|Ga0207700_10610329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium971Open in IMG/M
3300025928|Ga0207700_11787816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300025939|Ga0207665_11422496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300026118|Ga0207675_102247251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300026304|Ga0209240_1007799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4039Open in IMG/M
3300026310|Ga0209239_1074629All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300026489|Ga0257160_1047715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300026494|Ga0257159_1030999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium890Open in IMG/M
3300026494|Ga0257159_1039322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium796Open in IMG/M
3300026557|Ga0179587_10353621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium953Open in IMG/M
3300027310|Ga0207983_1036544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300028047|Ga0209526_10010683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium6327Open in IMG/M
3300028536|Ga0137415_10149082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2176Open in IMG/M
3300028720|Ga0307317_10261141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium585Open in IMG/M
3300029636|Ga0222749_10345675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300029636|Ga0222749_10426965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300030902|Ga0308202_1154498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300031231|Ga0170824_114877422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300031573|Ga0310915_10016967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4355Open in IMG/M
3300031720|Ga0307469_11813027Not Available590Open in IMG/M
3300031820|Ga0307473_10735708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300032180|Ga0307471_103736100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300034681|Ga0370546_081919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere19.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.95%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.95%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012180Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_006930902088090014SoilMLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEL
cont_0276.000044002166559005SimulatedMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKATAKDLEQRNER
F47_054684802170459009Grass SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLE
JGI11643J11755_1175786823300000787SoilMLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEL*
JGIcombinedJ26739_10103409223300002245Forest SoilMLTSKEYLQRAEQCSQLANASCDAYVKEALAELASEFKAMAKDLEQRNER*
JGI25390J43892_1004325613300002911Grasslands SoilGEFYLLAFGAVMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
JGI25617J43924_1000511613300002914Grasslands SoilMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER*
Ga0063356_10381785213300004463Arabidopsis Thaliana RhizosphereMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0062591_10229467423300004643SoilKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0066821_101125613300005147SoilMLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0066823_1001929623300005163SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER*
Ga0066690_1106047713300005177SoilAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER*
Ga0066678_1018659413300005181SoilMLTSKEYLQQAEDCSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER
Ga0070668_10066205923300005347Switchgrass RhizosphereMLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0070709_1009427023300005434Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA*
Ga0070713_10036761543300005436Corn, Switchgrass And Miscanthus RhizosphereQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0070710_1003774673300005437Corn, Switchgrass And Miscanthus RhizosphereAFGAVMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA*
Ga0070711_10081661113300005439Corn, Switchgrass And Miscanthus RhizosphereMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMA
Ga0070705_10034276823300005440Corn, Switchgrass And Miscanthus RhizosphereKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0070694_10005369843300005444Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0070707_10013046153300005468Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0070698_10083755333300005471Corn, Switchgrass And Miscanthus RhizosphereGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER*
Ga0070697_10165400323300005536Corn, Switchgrass And Miscanthus RhizosphereMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKD
Ga0070696_10193948613300005546Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNE
Ga0066704_1072884023300005557SoilMLTSKAYLQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR*
Ga0066706_1029230013300005598SoilTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0070717_1078999813300006028Corn, Switchgrass And Miscanthus RhizosphereAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER*
Ga0075368_1050903113300006042Populus EndosphereMLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA*
Ga0075432_1055091913300006058Populus RhizosphereMLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNER*
Ga0070715_1015943633300006163Corn, Switchgrass And Miscanthus RhizosphereMLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMA
Ga0075018_1024527113300006172WatershedsAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0070716_10020386313300006173Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQQAEECSQLANASSDVYVKKALTELASEFKATAKDVERATNADEE*
Ga0070712_10029592823300006175Corn, Switchgrass And Miscanthus RhizosphereMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0074064_1175383723300006603SoilMLTSKEYLQQAEECFQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0075421_10081094823300006845Populus RhizosphereMLTSKEYLQQAEDCSQLANAPSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0075433_1165471013300006852Populus RhizosphereTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0075425_10133777413300006854Populus RhizosphereMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNE
Ga0075425_10223735423300006854Populus RhizosphereMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFK
Ga0075434_10232684913300006871Populus RhizosphereMLTSKEYLQRAEECSQLANASGDVYVKKALTELACEFKATANNER*
Ga0075424_10130529913300006904Populus RhizosphereFGAVMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA*
Ga0075435_10138390723300007076Populus RhizosphereMLTSKEYLQRAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0075435_10194250213300007076Populus RhizosphereMLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEP*
Ga0099829_1030670543300009038Vadose Zone SoilMLTSKEYLQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR*
Ga0105247_1184756323300009101Switchgrass RhizosphereMLTSKEYLQRAEECSQLANASSDVYVKEALTELASDF
Ga0066709_10314740523300009137Grasslands SoilMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMA
Ga0111538_1204175413300009156Populus RhizosphereAFGAVMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0075423_1084929023300009162Populus RhizosphereMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLERRNER*
Ga0105249_1070161833300009553Switchgrass RhizosphereSKEYLQQAEECLQLANASSDVYVKEALTELASDFEAMAKELEQRNER*
Ga0127503_1007363933300010154SoilLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER*
Ga0134088_1008228013300010304Grasslands SoilAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0134125_1283781423300010371Terrestrial SoilGAVMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0134123_1291679213300010403Terrestrial SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKS
Ga0150983_1015183113300011120Forest SoilGAVMLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA*
Ga0150983_1351075033300011120Forest SoilGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0137392_1095159123300011269Vadose Zone SoilMLTSKEYLQQAEDCSRLANASSDVYVKEALTELASNFKAMAKDLARNER*
Ga0153974_109643423300012180Attine Ant Fungus GardensFLPAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0137364_1062078623300012198Vadose Zone SoilMLTSKEYLQQAEDCSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0137380_1083716913300012206Vadose Zone SoilMLRSKEYLQQAEECLQLATASSDVYVKEALTELAS
Ga0150985_11619911313300012212Avena Fatua RhizosphereKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA*
Ga0137371_1100746213300012356Vadose Zone SoilLAFGAVMLTSKEYLQQAEDCSQLANAPSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0137360_1023814213300012361Vadose Zone SoilRERSNYSANCAHERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER*
Ga0137398_1019242223300012683Vadose Zone SoilMLTSKEYLQQAEDCSRLANASSDVYVKEALTELASDFKAMAKDLDQRNER*
Ga0137359_1017455433300012923Vadose Zone SoilLGELYLLAFGAVMLTSKEYLQQAEDCSQLASASSDVYVKEALTELASDFKAMAKELEQRNER*
Ga0137359_1118507113300012923Vadose Zone SoilANCAHERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLEQRNER*
Ga0137413_1170221713300012924Vadose Zone SoilMLTSKEYLQQAEDCSQLASASSDVYVKEALTELASDFKAMAKELEQRNER*
Ga0162651_10002753523300012938SoilMLTSKAYLQQAEECLQLANASSDVYVKEALTELASDFKAMAENLDQRNER*
Ga0164303_1026861213300012957SoilMLTSKEYLQRAEECSQLANASSDVYVKDALTELAS
Ga0164301_1036944613300012960SoilMLTSKEYLQQAEECLQLANASSDVYVKDALTELSSDFKAMAKDLEQRNEH*
Ga0164308_1170297323300012985SoilLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER*
Ga0164304_1177300923300012986SoilMLTSKEYLQRAEECSQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH*
Ga0164306_1073142813300012988SoilKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEP*
Ga0132255_10506561113300015374Arabidopsis RhizosphereMLTSKEYVRQAEDCLQLANASTDVYVREALTELASDFKSIAK
Ga0182041_1060412623300016294SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELACEF
Ga0066662_1209536813300018468Grasslands SoilMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER
Ga0066662_1242140913300018468Grasslands SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA
Ga0066669_1080460623300018482Grasslands SoilMLTSKEYLEQAEDCSQLASASSDVYVKEALTELASDFKAMAKDLEQRNER
Ga0210407_1042688923300020579SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREHHGWMENATVGR
Ga0210387_1008337153300021405SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREHHGWMENA
Ga0210410_1018438843300021479SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREH
Ga0207663_1109442423300025916Corn, Switchgrass And Miscanthus RhizosphereMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEP
Ga0207646_1031115413300025922Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER
Ga0207646_1034408533300025922Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKAT
Ga0207700_1061032913300025928Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYVRQAEDCLQLANASSDVYVREALTELAS
Ga0207700_1178781613300025928Corn, Switchgrass And Miscanthus RhizosphereELYSRAFSAVILTSKEYLQQAEECLQLANASSDVYVKEALTELASDFEAMAKELEQRNER
Ga0207665_1142249613300025939Corn, Switchgrass And Miscanthus RhizosphereMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNE
Ga0207675_10224725113300026118Switchgrass RhizosphereLAFGAVMLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA
Ga0209240_100779923300026304Grasslands SoilMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER
Ga0209239_107462943300026310Grasslands SoilGAVMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER
Ga0257160_104771523300026489SoilYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH
Ga0257159_103099923300026494SoilMLTSKAYIQQAEECLQLANASGDVYVKEALTELASDFKAMAKDLDQRNER
Ga0257159_103932223300026494SoilMLTSKEYLQRAEECSQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH
Ga0179587_1035362113300026557Vadose Zone SoilMLTSKAYIQQAEECLQLANASSDVYVKDALTKLASDFKAMAKDLEQRNEH
Ga0207983_103654423300027310SoilVPSSAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER
Ga0209526_1001068343300028047Forest SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER
Ga0137415_1014908253300028536Vadose Zone SoilMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR
Ga0307317_1026114113300028720SoilMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKAFEQRERNA
Ga0222749_1034567523300029636SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEIKATAKDLEQRNER
Ga0222749_1042696513300029636SoilMLTSKEYVRQAEDCLQLAKASSDVYVREALTELASD
Ga0308202_115449813300030902SoilLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA
Ga0170824_11487742223300031231Forest SoilERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER
Ga0310915_1001696763300031573SoilMLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER
Ga0307469_1181302723300031720Hardwood Forest SoilMLTSKAYLQQAEECLQLANASSDVYVKKALTELACEFKATAKDLEQRNER
Ga0307473_1073570823300031820Hardwood Forest SoilMLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLDQRNER
Ga0307471_10373610013300032180Hardwood Forest SoilMLTSKAYLQQAEECLQFANASSDVYVKEALTELASEWPWTWKQR
Ga0370546_081919_257_4093300034681SoilMLTSKEYLQQAEDCSQLANASSDVYVKEALTELASNFKAIAKDLEQRNER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.