Basic Information | |
---|---|
Family ID | F096179 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 45 residues |
Representative Sequence | LTPLLLALGASLAWGVADFFGPLVSRTLGSLRVLFWAQVGGVAAIA |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 32.69 % |
% of genes near scaffold ends (potentially truncated) | 99.05 % |
% of genes from short scaffolds (< 2000 bps) | 96.19 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.238 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF01966 | HD | 87.62 |
PF06245 | DUF1015 | 4.76 |
PF07514 | TraI_2 | 1.90 |
PF02410 | RsfS | 0.95 |
PF08007 | JmjC_2 | 0.95 |
PF13662 | Toprim_4 | 0.95 |
PF05960 | DUF885 | 0.95 |
PF10609 | ParA | 0.95 |
PF08299 | Bac_DnaA_C | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 4.76 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.95 |
COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.24 % |
All Organisms | root | All Organisms | 44.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908043|A2_c1_ConsensusfromContig59644 | Not Available | 611 | Open in IMG/M |
3300001532|A20PFW1_1321741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 746 | Open in IMG/M |
3300001535|A3PFW1_10572801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 514 | Open in IMG/M |
3300001536|A1565W1_10316709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 772 | Open in IMG/M |
3300001538|A10PFW1_10135773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 625 | Open in IMG/M |
3300001538|A10PFW1_10293484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1407 | Open in IMG/M |
3300002568|C688J35102_120456068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1083 | Open in IMG/M |
3300004081|Ga0063454_100740724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 748 | Open in IMG/M |
3300005181|Ga0066678_10164715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1396 | Open in IMG/M |
3300005181|Ga0066678_10287546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1073 | Open in IMG/M |
3300005329|Ga0070683_100648845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1011 | Open in IMG/M |
3300005436|Ga0070713_101441397 | Not Available | 668 | Open in IMG/M |
3300005454|Ga0066687_10737423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 586 | Open in IMG/M |
3300005455|Ga0070663_101513485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 597 | Open in IMG/M |
3300005539|Ga0068853_101037830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300005713|Ga0066905_102271759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 507 | Open in IMG/M |
3300005834|Ga0068851_10864104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 565 | Open in IMG/M |
3300005949|Ga0066791_10133607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 509 | Open in IMG/M |
3300006028|Ga0070717_11502795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 611 | Open in IMG/M |
3300006031|Ga0066651_10345868 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300009038|Ga0099829_11131995 | Not Available | 649 | Open in IMG/M |
3300009098|Ga0105245_11398524 | Not Available | 750 | Open in IMG/M |
3300009137|Ga0066709_102809887 | Not Available | 646 | Open in IMG/M |
3300009137|Ga0066709_103698881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 555 | Open in IMG/M |
3300009176|Ga0105242_12126253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 605 | Open in IMG/M |
3300009792|Ga0126374_11233220 | Not Available | 601 | Open in IMG/M |
3300010036|Ga0126305_10601033 | Not Available | 739 | Open in IMG/M |
3300010039|Ga0126309_10248974 | Not Available | 1006 | Open in IMG/M |
3300010361|Ga0126378_10543177 | Not Available | 1277 | Open in IMG/M |
3300010375|Ga0105239_13644795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300010376|Ga0126381_102279496 | Not Available | 778 | Open in IMG/M |
3300010885|Ga0133913_11916176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1477 | Open in IMG/M |
3300012011|Ga0120152_1119547 | Not Available | 726 | Open in IMG/M |
3300012206|Ga0137380_10944828 | Not Available | 739 | Open in IMG/M |
3300012207|Ga0137381_10393210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1209 | Open in IMG/M |
3300012948|Ga0126375_11353894 | Not Available | 601 | Open in IMG/M |
3300012958|Ga0164299_10765787 | Not Available | 684 | Open in IMG/M |
3300012985|Ga0164308_10542726 | Not Available | 980 | Open in IMG/M |
3300012985|Ga0164308_10791514 | Not Available | 826 | Open in IMG/M |
3300012985|Ga0164308_11386671 | Not Available | 641 | Open in IMG/M |
3300013104|Ga0157370_11066823 | Not Available | 730 | Open in IMG/M |
3300013307|Ga0157372_13041364 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300015203|Ga0167650_1061529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 921 | Open in IMG/M |
3300017959|Ga0187779_10900843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
3300017966|Ga0187776_10953540 | Not Available | 627 | Open in IMG/M |
3300017994|Ga0187822_10225953 | Not Available | 634 | Open in IMG/M |
3300018060|Ga0187765_10856393 | Not Available | 611 | Open in IMG/M |
3300020081|Ga0206354_11577805 | Not Available | 551 | Open in IMG/M |
3300020082|Ga0206353_10552454 | Not Available | 629 | Open in IMG/M |
3300021363|Ga0193699_10175520 | Not Available | 886 | Open in IMG/M |
3300024232|Ga0247664_1050160 | Not Available | 966 | Open in IMG/M |
3300024331|Ga0247668_1075171 | Not Available | 683 | Open in IMG/M |
3300025505|Ga0207929_1114601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300025898|Ga0207692_10339418 | Not Available | 924 | Open in IMG/M |
3300025915|Ga0207693_10172319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1704 | Open in IMG/M |
3300025917|Ga0207660_10783307 | Not Available | 778 | Open in IMG/M |
3300025920|Ga0207649_11033418 | Not Available | 647 | Open in IMG/M |
3300025921|Ga0207652_10743449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 873 | Open in IMG/M |
3300025929|Ga0207664_10639543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 956 | Open in IMG/M |
3300025932|Ga0207690_10354788 | Not Available | 1160 | Open in IMG/M |
3300025939|Ga0207665_11116139 | Not Available | 629 | Open in IMG/M |
3300025944|Ga0207661_10516519 | Not Available | 1092 | Open in IMG/M |
3300025944|Ga0207661_10705100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 928 | Open in IMG/M |
3300025949|Ga0207667_10615969 | Not Available | 1093 | Open in IMG/M |
3300026041|Ga0207639_11943588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300026075|Ga0207708_11175006 | Not Available | 670 | Open in IMG/M |
3300026089|Ga0207648_12208862 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300026142|Ga0207698_11179732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 779 | Open in IMG/M |
3300026538|Ga0209056_10593903 | Not Available | 559 | Open in IMG/M |
3300027773|Ga0209810_1057880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1970 | Open in IMG/M |
3300028800|Ga0265338_11017559 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300028828|Ga0307312_10226735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1205 | Open in IMG/M |
3300028875|Ga0307289_10253944 | Not Available | 723 | Open in IMG/M |
3300030336|Ga0247826_10372167 | Not Available | 1047 | Open in IMG/M |
3300031235|Ga0265330_10165973 | Not Available | 937 | Open in IMG/M |
3300031546|Ga0318538_10805626 | Not Available | 510 | Open in IMG/M |
3300031564|Ga0318573_10031053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2500 | Open in IMG/M |
3300031640|Ga0318555_10211392 | Not Available | 1046 | Open in IMG/M |
3300031711|Ga0265314_10486497 | Not Available | 652 | Open in IMG/M |
3300031723|Ga0318493_10699355 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031765|Ga0318554_10324658 | Not Available | 875 | Open in IMG/M |
3300031781|Ga0318547_10114592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1556 | Open in IMG/M |
3300031782|Ga0318552_10510146 | Not Available | 614 | Open in IMG/M |
3300031782|Ga0318552_10612292 | Not Available | 556 | Open in IMG/M |
3300031805|Ga0318497_10028412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2776 | Open in IMG/M |
3300031890|Ga0306925_12239055 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031894|Ga0318522_10273880 | Not Available | 640 | Open in IMG/M |
3300031896|Ga0318551_10875327 | Not Available | 524 | Open in IMG/M |
3300031912|Ga0306921_10963518 | Not Available | 965 | Open in IMG/M |
3300031938|Ga0308175_100745320 | Not Available | 1067 | Open in IMG/M |
3300031939|Ga0308174_11572464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 564 | Open in IMG/M |
3300031996|Ga0308176_11277142 | Not Available | 780 | Open in IMG/M |
3300031996|Ga0308176_12527986 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032008|Ga0318562_10108149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1583 | Open in IMG/M |
3300032067|Ga0318524_10704129 | Not Available | 533 | Open in IMG/M |
3300032074|Ga0308173_12218965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
3300032180|Ga0307471_104336759 | Not Available | 501 | Open in IMG/M |
3300032782|Ga0335082_10585738 | Not Available | 977 | Open in IMG/M |
3300032892|Ga0335081_12126926 | Not Available | 594 | Open in IMG/M |
3300032897|Ga0335071_10038409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4741 | Open in IMG/M |
3300033004|Ga0335084_10719984 | Not Available | 1016 | Open in IMG/M |
3300033758|Ga0314868_018626 | Not Available | 737 | Open in IMG/M |
3300033803|Ga0314862_0067023 | Not Available | 797 | Open in IMG/M |
3300033805|Ga0314864_0075869 | Not Available | 797 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_c1_00805220 | 2124908043 | Soil | LTALVLALGASLAWGVADFVGPLVARTLGALRVLFW |
A20PFW1_13217411 | 3300001532 | Permafrost | LGSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAI |
A3PFW1_105728012 | 3300001535 | Permafrost | LTPLLLALAASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLA |
A1565W1_103167093 | 3300001536 | Permafrost | LSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAIALAV |
A10PFW1_101357732 | 3300001538 | Permafrost | LSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAIALAVAIRGQG |
A10PFW1_102934843 | 3300001538 | Permafrost | LNALALALGASLAWGVADFVGPLVGRALGTLRVLF |
C688J35102_1204560683 | 3300002568 | Soil | LTPLLLALGASIAWGVADFVGPLLGRTLGILRIMFWGQVGGL |
Ga0063454_1007407242 | 3300004081 | Soil | LTPLLLALGASLAWGVADFFGPLVSRTLGSLRVLFWAQVGGVAAIA |
Ga0066678_101647153 | 3300005181 | Soil | LNPLLLALGASLVWGVADFTGPLVSRALGTLRVLFWAQVGGVA |
Ga0066678_102875461 | 3300005181 | Soil | LTAALLLALGASLAWGVADFVGPWRGRTLGALRVMLWAQI |
Ga0070683_1006488451 | 3300005329 | Corn Rhizosphere | LTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGV |
Ga0070713_1014413972 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAALLLALGASLAWGVADFVGPWQGRALGTLRVMLWAQLGGIAL |
Ga0066687_107374231 | 3300005454 | Soil | LTAALLLALGASLAWGVADFVGPWQGRTLGALRVMLWAQIGGIALLGIVMA |
Ga0070663_1015134851 | 3300005455 | Corn Rhizosphere | LTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWAQVGGVASIAVAM |
Ga0068853_1010378301 | 3300005539 | Corn Rhizosphere | LTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRAQGPAGWGVLYAIGASFG |
Ga0066905_1022717591 | 3300005713 | Tropical Forest Soil | VLLALGASLAWGVGDFVGPWQGKTFGVLRVMLWAQLGGL |
Ga0068851_108641042 | 3300005834 | Corn Rhizosphere | LTPLLLALGASLAWGVGDFFGPLISRTAGVLPVLMWAQVGGVASLAVAMAIRAEGP |
Ga0066791_101336072 | 3300005949 | Soil | MTGVLLALGASLAWGVADFVGPWKARTLGALRVMLWAQFGGLTAITIVVAIHAKP |
Ga0070717_115027952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLLLALAASLAWGIGDFVGPLLSRAEGVLPVLFWAQIGGC |
Ga0066651_103458681 | 3300006031 | Soil | VTALLALGASFAWGVADFVGPLKARTLGTLRVLLWAQVGGLVAIAAAVAAR |
Ga0099829_111319952 | 3300009038 | Vadose Zone Soil | LTAVLLALGASLSWGLADFVGPLKGRTLGALRVLFVAQACGVL |
Ga0105245_113985241 | 3300009098 | Miscanthus Rhizosphere | LTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGLAGIAI |
Ga0066709_1028098871 | 3300009137 | Grasslands Soil | LTPLLLPLGASLAWVVADFVGPLFSRTGGTLPILLWGQIGG |
Ga0066709_1036988813 | 3300009137 | Grasslands Soil | VTPALLALGASVAWGFADFVGPLWARTWGTLRVLLWAQVGGLAAIGAAVAI |
Ga0105242_121262531 | 3300009176 | Miscanthus Rhizosphere | VTALLLALGASLAWGVADFVGPWQGRTLGALRVMFWAQVAGVTAVALVVLAR |
Ga0126374_112332202 | 3300009792 | Tropical Forest Soil | LTEALLLALGASLAWGVGDFVGPWQGKTFGVLRVMLWAQLGGLVLVAILVAVRGRPPD |
Ga0126305_106010331 | 3300010036 | Serpentine Soil | LTAVLLALGASLAWGGADFVGPLKGRTLGTLRVLLWAQVAGLAAIAAVV |
Ga0126309_102489741 | 3300010039 | Serpentine Soil | LTAVLLALGASLAWGVADFAGPLKGRTLGTLRVLLWAQVG |
Ga0126378_105431773 | 3300010361 | Tropical Forest Soil | MLALGASLAWGVADFVGPLWGRTWGALRVLLWAQIGGLAAIAI |
Ga0105239_136447951 | 3300010375 | Corn Rhizosphere | LTPLLLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQ |
Ga0126381_1022794961 | 3300010376 | Tropical Forest Soil | LTAFTLALGASLAWGVADFVGPLWGRTWGVLRVLLWAQIGGLAAIAI |
Ga0133913_119161763 | 3300010885 | Freshwater Lake | VTGLLLALGASLSWGVADFVGPWQGRTLGVLRVMVWAQAAGVIGIALVVAFVWKAPPGY |
Ga0120152_11195472 | 3300012011 | Permafrost | LTPLLFALGASLAWGVGDFFGPLVSRTLGVLPVLMWAHIGG |
Ga0137380_109448282 | 3300012206 | Vadose Zone Soil | LTPLLLALGASLVWGVADFTGPLLSRALGTLRVLFWAQVGGVAALVPVLAVRAEA |
Ga0137381_103932101 | 3300012207 | Vadose Zone Soil | LTAALLLALGASLAWGVADFVGPWRGRTLGALRVMLWAQIGGIAL |
Ga0126375_113538941 | 3300012948 | Tropical Forest Soil | VNSLLLALGASLAWGVADFVGPWQGRILGALRVMLWAQVA |
Ga0164299_107657871 | 3300012958 | Soil | LSPLLLALGASLAWGVADFVGPLISRTLGTLRVLFW |
Ga0164308_105427261 | 3300012985 | Soil | LTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGFAGIAIVVAIR |
Ga0164308_107915141 | 3300012985 | Soil | LTPLLLALGASLAWGVADFAGPLISRTLGTLRVLFW |
Ga0164308_113866711 | 3300012985 | Soil | LTALALALGASIAWGVSDFVGPLVARALGSLRVLFWA |
Ga0157370_110668231 | 3300013104 | Corn Rhizosphere | LTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGGASLAVAAAIRGQGPAGWG |
Ga0157372_130413642 | 3300013307 | Corn Rhizosphere | LTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWA |
Ga0167650_10615291 | 3300015203 | Glacier Forefield Soil | LTSLLLALGASLAWGVADFVGPLVSRTLGALRIMFWGQVGGLAAIAAIV |
Ga0187779_109008431 | 3300017959 | Tropical Peatland | VTGVLLALGASLAWGVADFAGPFQARTLGTFRVLLWAQ |
Ga0187776_109535402 | 3300017966 | Tropical Peatland | VTAVLLALGASLAWGVADFVGPWQARTLGALRVMLWAQVVGVTA |
Ga0187822_102259531 | 3300017994 | Freshwater Sediment | LTAALLFALGASLAWGVADFVGPWQGRTLGALRVLLW |
Ga0187765_108563931 | 3300018060 | Tropical Peatland | VSGLLLALGASLAWGVADFVGPWQGRTLGVLRVLVWAELAGAVAVG |
Ga0206354_115778051 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRGQGPAGW |
Ga0206353_105524541 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLLLALGASLAWGVADFVGPLLGRTLGVLRIMFW |
Ga0193699_101755202 | 3300021363 | Soil | LTPLLLALGASLAWGVADFVGPLLSRTLGVLRIMFWAQVGGLTGIAI |
Ga0247664_10501601 | 3300024232 | Soil | LTPLLLALGASIAWGVADFVGPLISRTWGTLRVMFWAQIG |
Ga0247668_10751711 | 3300024331 | Soil | LSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVLAIALAVAI |
Ga0207929_11146012 | 3300025505 | Arctic Peat Soil | LSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQ |
Ga0207692_103394182 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPLLLALGASLAWGVGDFVGPLLSRMLGVLRVLFWVEVGGLAAIAVAV |
Ga0207707_106186402 | 3300025912 | Corn Rhizosphere | LSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVIAIALAVAIRGQGPAGWAVLFAILASLG |
Ga0207693_101723193 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLLLALGASIAWGVADFVGPLISRTWGTLRVMFWAQIGGFAGI |
Ga0207660_107833071 | 3300025917 | Corn Rhizosphere | LSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGV |
Ga0207649_110334182 | 3300025920 | Corn Rhizosphere | LTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIG |
Ga0207652_107434492 | 3300025921 | Corn Rhizosphere | LTPLLLALGASLAWGVADFVGPLFSRTLGSIRVLFWAQVGGVAAIA |
Ga0207664_106395431 | 3300025929 | Agricultural Soil | LTPLLLALGASLAWGVSDFFGPLVSRTLGSLRVLFWAQVGGCASIALAVAIHGRGPAG |
Ga0207690_103547881 | 3300025932 | Corn Rhizosphere | LTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAV |
Ga0207665_111161392 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLLLALGASLAWGISDFVGPLFSRTLGILRVLFWGQLGG |
Ga0207661_105165191 | 3300025944 | Corn Rhizosphere | LTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRGQGP |
Ga0207661_107051002 | 3300025944 | Corn Rhizosphere | LTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWAQVGGVASIAVAMA |
Ga0207667_106159691 | 3300025949 | Corn Rhizosphere | LSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVIAIALAVAIR |
Ga0207639_119435881 | 3300026041 | Corn Rhizosphere | LTPLLLALGASLAWGVSDFVGPLVARAAGTLRVLFWAQIG |
Ga0207708_111750062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLLALGASLAWGVADFVGPWQARTWGTLRVLLW |
Ga0207648_122088622 | 3300026089 | Miscanthus Rhizosphere | LTPLLLALGASLAWGVADFAGPLISRTLGTLRVLF |
Ga0207698_111797322 | 3300026142 | Corn Rhizosphere | MPALVSRRPTPLLLALSASLAWGVADFVGPVWARTLGTLRVLLWAQVGGV |
Ga0209056_105939032 | 3300026538 | Soil | VSLLLALGASLAWGVADFAGPLKGRTLGALPVLLWA |
Ga0209810_10578803 | 3300027773 | Surface Soil | VSDTGALFLALGASLAWGVADFVGPLWGRTFGALRV |
Ga0265338_110175592 | 3300028800 | Rhizosphere | VNEVLLALGASLAWGVADFVGPWQGHALGALRVMLWSQVAGL |
Ga0307312_102267353 | 3300028828 | Soil | VPAALLLALSASLAWGVTDFVGPWQGRAFGALRVMLWGQFGGVIAIAI |
Ga0307289_102539441 | 3300028875 | Soil | LTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGLA |
Ga0247826_103721671 | 3300030336 | Soil | VTAVLLALGASLVWGVADFVGPLQARTHGTLRVLMWVQVGGLT |
Ga0265330_101659731 | 3300031235 | Rhizosphere | LTPLLLALGASLAWGVADFVGPLVSRTLGMLPVLFWAQIGVVLALA |
Ga0318538_108056262 | 3300031546 | Soil | LSALALALGASLAWGVADFVGPLWGRTWGALRVLLWA |
Ga0318573_100310531 | 3300031564 | Soil | LSALLLALGASLAWGVADFVGPLWGRTWGALRVLL |
Ga0318555_102113921 | 3300031640 | Soil | VNGLLLALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAIAVAIR |
Ga0265314_104864972 | 3300031711 | Rhizosphere | LSPLILALSASLTWGVADFVGPLRARTLGTLPVLLWAQVGGLVAI |
Ga0318493_106993551 | 3300031723 | Soil | VNALLLALGASLAWGVADFVGPWQGRTLGALRVMLWGQIAGFTTLI |
Ga0318554_103246581 | 3300031765 | Soil | LSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAVAVA |
Ga0318547_101145923 | 3300031781 | Soil | LSALLLALGASLAWGVADFVGPLWGRTWGALRVLLWAELGGLAGIALAV |
Ga0318552_105101461 | 3300031782 | Soil | LTPLLLALGASIAWGIADFAGPLISRTFGALRILFWAQVG |
Ga0318552_106122921 | 3300031782 | Soil | VNGLALALGASLAWGVADFVGPWQGRTLGTLRVLRWA |
Ga0318497_100284121 | 3300031805 | Soil | LSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIA |
Ga0306925_122390551 | 3300031890 | Soil | LTALALALGASLAWGVADFVGPLWGRTWGALRVMFWAQVGGLAGIALAAVARGE |
Ga0318522_102738801 | 3300031894 | Soil | LTALALALGASLAWGVADFVGPLWGRTWGALRVMFWAQVGGLAG |
Ga0318551_108753272 | 3300031896 | Soil | VNGLLLALGASLAWGVADFVGPWQGRTLGALRVMFWAQVAGVSA |
Ga0306921_109635182 | 3300031912 | Soil | VNALLLALGASLAWGVADFVGPWQGRTLGALRVMLWGQ |
Ga0308175_1007453201 | 3300031938 | Soil | LTPLLLALGASLAWGVGDFFGPLISRSVGVLPVLLWAQVGGVASLAV |
Ga0308174_115724641 | 3300031939 | Soil | LTPLLLALGASLAWGVGDFFGPLISRSVGVLPVLLWAQVGGVASLAVAVAI |
Ga0308176_112771422 | 3300031996 | Soil | LTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLM |
Ga0308176_125279862 | 3300031996 | Soil | LTPLLLALGASFAWGVGDFFGPLISRTLGVLPVLLWAQVGGVA |
Ga0318562_101081493 | 3300032008 | Soil | VTGLLLALGASLAWGVADFAGPFQARTLGTFRVLLWAQ |
Ga0318524_107041291 | 3300032067 | Soil | LTPLLLALGASIAWGIADFAGPLISRTFGALRILFWAQV |
Ga0308173_122189652 | 3300032074 | Soil | VSSALLALGASVAWGFADVVGPLWARTRGTLRVLLWAQVGGV |
Ga0307471_1043367592 | 3300032180 | Hardwood Forest Soil | LNPLLLALGASLAWGVADFTGPLVSRTFGALRILFWAQVGGVIGIAIAVGARAEGPA |
Ga0335082_105857381 | 3300032782 | Soil | LTPLLLALGASLAWGVADFVGPLVSRTLGSLPVLFWA |
Ga0335081_121269262 | 3300032892 | Soil | VTSLLLALGASLAWGVADFVGPWQARALGSLRVMLWAQLAGAVAMCVV |
Ga0335071_100384091 | 3300032897 | Soil | LSAFALALGASLAWGVADFVGPLWGRTWGALRVLLWAQVGGVVAIAIAVALRGQ |
Ga0335084_107199841 | 3300033004 | Soil | LTALALALGASLAWGVADFVGPLWGRTWGALRVMLWAQLAGVAAIAVAVAIR |
Ga0314868_018626_1_117 | 3300033758 | Peatland | MSALALALGASLAWGVADFVGPLWGRTWGALRVMLWAQL |
Ga0314862_0067023_1_153 | 3300033803 | Peatland | LSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAVAVAI |
Ga0314864_0075869_2_142 | 3300033805 | Peatland | MSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAV |
⦗Top⦘ |