NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096179

Metagenome / Metatranscriptome Family F096179

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096179
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 45 residues
Representative Sequence LTPLLLALGASLAWGVADFFGPLVSRTLGSLRVLFWAQVGGVAAIA
Number of Associated Samples 97
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 32.69 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 96.19 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (55.238 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(23.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 59.46%    β-sheet: 0.00%    Coil/Unstructured: 40.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF01966HD 87.62
PF06245DUF1015 4.76
PF07514TraI_2 1.90
PF02410RsfS 0.95
PF08007JmjC_2 0.95
PF13662Toprim_4 0.95
PF05960DUF885 0.95
PF10609ParA 0.95
PF08299Bac_DnaA_C 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 4.76
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.95
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.95
COG2850Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domainTranslation, ribosomal structure and biogenesis [J] 0.95
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A55.24 %
All OrganismsrootAll Organisms44.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig59644Not Available611Open in IMG/M
3300001532|A20PFW1_1321741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei746Open in IMG/M
3300001535|A3PFW1_10572801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei514Open in IMG/M
3300001536|A1565W1_10316709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei772Open in IMG/M
3300001538|A10PFW1_10135773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei625Open in IMG/M
3300001538|A10PFW1_10293484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1407Open in IMG/M
3300002568|C688J35102_120456068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1083Open in IMG/M
3300004081|Ga0063454_100740724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei748Open in IMG/M
3300005181|Ga0066678_10164715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1396Open in IMG/M
3300005181|Ga0066678_10287546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1073Open in IMG/M
3300005329|Ga0070683_100648845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1011Open in IMG/M
3300005436|Ga0070713_101441397Not Available668Open in IMG/M
3300005454|Ga0066687_10737423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia586Open in IMG/M
3300005455|Ga0070663_101513485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia597Open in IMG/M
3300005539|Ga0068853_101037830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300005713|Ga0066905_102271759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales507Open in IMG/M
3300005834|Ga0068851_10864104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia565Open in IMG/M
3300005949|Ga0066791_10133607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei509Open in IMG/M
3300006028|Ga0070717_11502795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales611Open in IMG/M
3300006031|Ga0066651_10345868All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300009038|Ga0099829_11131995Not Available649Open in IMG/M
3300009098|Ga0105245_11398524Not Available750Open in IMG/M
3300009137|Ga0066709_102809887Not Available646Open in IMG/M
3300009137|Ga0066709_103698881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria555Open in IMG/M
3300009176|Ga0105242_12126253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia605Open in IMG/M
3300009792|Ga0126374_11233220Not Available601Open in IMG/M
3300010036|Ga0126305_10601033Not Available739Open in IMG/M
3300010039|Ga0126309_10248974Not Available1006Open in IMG/M
3300010361|Ga0126378_10543177Not Available1277Open in IMG/M
3300010375|Ga0105239_13644795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300010376|Ga0126381_102279496Not Available778Open in IMG/M
3300010885|Ga0133913_11916176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1477Open in IMG/M
3300012011|Ga0120152_1119547Not Available726Open in IMG/M
3300012206|Ga0137380_10944828Not Available739Open in IMG/M
3300012207|Ga0137381_10393210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1209Open in IMG/M
3300012948|Ga0126375_11353894Not Available601Open in IMG/M
3300012958|Ga0164299_10765787Not Available684Open in IMG/M
3300012985|Ga0164308_10542726Not Available980Open in IMG/M
3300012985|Ga0164308_10791514Not Available826Open in IMG/M
3300012985|Ga0164308_11386671Not Available641Open in IMG/M
3300013104|Ga0157370_11066823Not Available730Open in IMG/M
3300013307|Ga0157372_13041364All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300015203|Ga0167650_1061529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei921Open in IMG/M
3300017959|Ga0187779_10900843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300017966|Ga0187776_10953540Not Available627Open in IMG/M
3300017994|Ga0187822_10225953Not Available634Open in IMG/M
3300018060|Ga0187765_10856393Not Available611Open in IMG/M
3300020081|Ga0206354_11577805Not Available551Open in IMG/M
3300020082|Ga0206353_10552454Not Available629Open in IMG/M
3300021363|Ga0193699_10175520Not Available886Open in IMG/M
3300024232|Ga0247664_1050160Not Available966Open in IMG/M
3300024331|Ga0247668_1075171Not Available683Open in IMG/M
3300025505|Ga0207929_1114601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300025898|Ga0207692_10339418Not Available924Open in IMG/M
3300025915|Ga0207693_10172319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1704Open in IMG/M
3300025917|Ga0207660_10783307Not Available778Open in IMG/M
3300025920|Ga0207649_11033418Not Available647Open in IMG/M
3300025921|Ga0207652_10743449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei873Open in IMG/M
3300025929|Ga0207664_10639543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei956Open in IMG/M
3300025932|Ga0207690_10354788Not Available1160Open in IMG/M
3300025939|Ga0207665_11116139Not Available629Open in IMG/M
3300025944|Ga0207661_10516519Not Available1092Open in IMG/M
3300025944|Ga0207661_10705100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei928Open in IMG/M
3300025949|Ga0207667_10615969Not Available1093Open in IMG/M
3300026041|Ga0207639_11943588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300026075|Ga0207708_11175006Not Available670Open in IMG/M
3300026089|Ga0207648_12208862All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300026142|Ga0207698_11179732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria779Open in IMG/M
3300026538|Ga0209056_10593903Not Available559Open in IMG/M
3300027773|Ga0209810_1057880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1970Open in IMG/M
3300028800|Ga0265338_11017559All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300028828|Ga0307312_10226735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1205Open in IMG/M
3300028875|Ga0307289_10253944Not Available723Open in IMG/M
3300030336|Ga0247826_10372167Not Available1047Open in IMG/M
3300031235|Ga0265330_10165973Not Available937Open in IMG/M
3300031546|Ga0318538_10805626Not Available510Open in IMG/M
3300031564|Ga0318573_10031053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2500Open in IMG/M
3300031640|Ga0318555_10211392Not Available1046Open in IMG/M
3300031711|Ga0265314_10486497Not Available652Open in IMG/M
3300031723|Ga0318493_10699355All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031765|Ga0318554_10324658Not Available875Open in IMG/M
3300031781|Ga0318547_10114592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1556Open in IMG/M
3300031782|Ga0318552_10510146Not Available614Open in IMG/M
3300031782|Ga0318552_10612292Not Available556Open in IMG/M
3300031805|Ga0318497_10028412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2776Open in IMG/M
3300031890|Ga0306925_12239055All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031894|Ga0318522_10273880Not Available640Open in IMG/M
3300031896|Ga0318551_10875327Not Available524Open in IMG/M
3300031912|Ga0306921_10963518Not Available965Open in IMG/M
3300031938|Ga0308175_100745320Not Available1067Open in IMG/M
3300031939|Ga0308174_11572464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia564Open in IMG/M
3300031996|Ga0308176_11277142Not Available780Open in IMG/M
3300031996|Ga0308176_12527986All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032008|Ga0318562_10108149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1583Open in IMG/M
3300032067|Ga0318524_10704129Not Available533Open in IMG/M
3300032074|Ga0308173_12218965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300032180|Ga0307471_104336759Not Available501Open in IMG/M
3300032782|Ga0335082_10585738Not Available977Open in IMG/M
3300032892|Ga0335081_12126926Not Available594Open in IMG/M
3300032897|Ga0335071_10038409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4741Open in IMG/M
3300033004|Ga0335084_10719984Not Available1016Open in IMG/M
3300033758|Ga0314868_018626Not Available737Open in IMG/M
3300033803|Ga0314862_0067023Not Available797Open in IMG/M
3300033805|Ga0314864_0075869Not Available797Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.67%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.86%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.86%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.95%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.95%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_008052202124908043SoilLTALVLALGASLAWGVADFVGPLVARTLGALRVLFW
A20PFW1_132174113300001532PermafrostLGSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAI
A3PFW1_1057280123300001535PermafrostLTPLLLALAASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLA
A1565W1_1031670933300001536PermafrostLSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAIALAV
A10PFW1_1013577323300001538PermafrostLSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQVGGLLAIALAVAIRGQG
A10PFW1_1029348433300001538PermafrostLNALALALGASLAWGVADFVGPLVGRALGTLRVLF
C688J35102_12045606833300002568SoilLTPLLLALGASIAWGVADFVGPLLGRTLGILRIMFWGQVGGL
Ga0063454_10074072423300004081SoilLTPLLLALGASLAWGVADFFGPLVSRTLGSLRVLFWAQVGGVAAIA
Ga0066678_1016471533300005181SoilLNPLLLALGASLVWGVADFTGPLVSRALGTLRVLFWAQVGGVA
Ga0066678_1028754613300005181SoilLTAALLLALGASLAWGVADFVGPWRGRTLGALRVMLWAQI
Ga0070683_10064884513300005329Corn RhizosphereLTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGV
Ga0070713_10144139723300005436Corn, Switchgrass And Miscanthus RhizosphereMTAALLLALGASLAWGVADFVGPWQGRALGTLRVMLWAQLGGIAL
Ga0066687_1073742313300005454SoilLTAALLLALGASLAWGVADFVGPWQGRTLGALRVMLWAQIGGIALLGIVMA
Ga0070663_10151348513300005455Corn RhizosphereLTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWAQVGGVASIAVAM
Ga0068853_10103783013300005539Corn RhizosphereLTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRAQGPAGWGVLYAIGASFG
Ga0066905_10227175913300005713Tropical Forest SoilVLLALGASLAWGVGDFVGPWQGKTFGVLRVMLWAQLGGL
Ga0068851_1086410423300005834Corn RhizosphereLTPLLLALGASLAWGVGDFFGPLISRTAGVLPVLMWAQVGGVASLAVAMAIRAEGP
Ga0066791_1013360723300005949SoilMTGVLLALGASLAWGVADFVGPWKARTLGALRVMLWAQFGGLTAITIVVAIHAKP
Ga0070717_1150279523300006028Corn, Switchgrass And Miscanthus RhizosphereLTPLLLALAASLAWGIGDFVGPLLSRAEGVLPVLFWAQIGGC
Ga0066651_1034586813300006031SoilVTALLALGASFAWGVADFVGPLKARTLGTLRVLLWAQVGGLVAIAAAVAAR
Ga0099829_1113199523300009038Vadose Zone SoilLTAVLLALGASLSWGLADFVGPLKGRTLGALRVLFVAQACGVL
Ga0105245_1139852413300009098Miscanthus RhizosphereLTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGLAGIAI
Ga0066709_10280988713300009137Grasslands SoilLTPLLLPLGASLAWVVADFVGPLFSRTGGTLPILLWGQIGG
Ga0066709_10369888133300009137Grasslands SoilVTPALLALGASVAWGFADFVGPLWARTWGTLRVLLWAQVGGLAAIGAAVAI
Ga0105242_1212625313300009176Miscanthus RhizosphereVTALLLALGASLAWGVADFVGPWQGRTLGALRVMFWAQVAGVTAVALVVLAR
Ga0126374_1123322023300009792Tropical Forest SoilLTEALLLALGASLAWGVGDFVGPWQGKTFGVLRVMLWAQLGGLVLVAILVAVRGRPPD
Ga0126305_1060103313300010036Serpentine SoilLTAVLLALGASLAWGGADFVGPLKGRTLGTLRVLLWAQVAGLAAIAAVV
Ga0126309_1024897413300010039Serpentine SoilLTAVLLALGASLAWGVADFAGPLKGRTLGTLRVLLWAQVG
Ga0126378_1054317733300010361Tropical Forest SoilMLALGASLAWGVADFVGPLWGRTWGALRVLLWAQIGGLAAIAI
Ga0105239_1364479513300010375Corn RhizosphereLTPLLLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQ
Ga0126381_10227949613300010376Tropical Forest SoilLTAFTLALGASLAWGVADFVGPLWGRTWGVLRVLLWAQIGGLAAIAI
Ga0133913_1191617633300010885Freshwater LakeVTGLLLALGASLSWGVADFVGPWQGRTLGVLRVMVWAQAAGVIGIALVVAFVWKAPPGY
Ga0120152_111954723300012011PermafrostLTPLLFALGASLAWGVGDFFGPLVSRTLGVLPVLMWAHIGG
Ga0137380_1094482823300012206Vadose Zone SoilLTPLLLALGASLVWGVADFTGPLLSRALGTLRVLFWAQVGGVAALVPVLAVRAEA
Ga0137381_1039321013300012207Vadose Zone SoilLTAALLLALGASLAWGVADFVGPWRGRTLGALRVMLWAQIGGIAL
Ga0126375_1135389413300012948Tropical Forest SoilVNSLLLALGASLAWGVADFVGPWQGRILGALRVMLWAQVA
Ga0164299_1076578713300012958SoilLSPLLLALGASLAWGVADFVGPLISRTLGTLRVLFW
Ga0164308_1054272613300012985SoilLTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGFAGIAIVVAIR
Ga0164308_1079151413300012985SoilLTPLLLALGASLAWGVADFAGPLISRTLGTLRVLFW
Ga0164308_1138667113300012985SoilLTALALALGASIAWGVSDFVGPLVARALGSLRVLFWA
Ga0157370_1106682313300013104Corn RhizosphereLTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGGASLAVAAAIRGQGPAGWG
Ga0157372_1304136423300013307Corn RhizosphereLTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWA
Ga0167650_106152913300015203Glacier Forefield SoilLTSLLLALGASLAWGVADFVGPLVSRTLGALRIMFWGQVGGLAAIAAIV
Ga0187779_1090084313300017959Tropical PeatlandVTGVLLALGASLAWGVADFAGPFQARTLGTFRVLLWAQ
Ga0187776_1095354023300017966Tropical PeatlandVTAVLLALGASLAWGVADFVGPWQARTLGALRVMLWAQVVGVTA
Ga0187822_1022595313300017994Freshwater SedimentLTAALLFALGASLAWGVADFVGPWQGRTLGALRVLLW
Ga0187765_1085639313300018060Tropical PeatlandVSGLLLALGASLAWGVADFVGPWQGRTLGVLRVLVWAELAGAVAVG
Ga0206354_1157780513300020081Corn, Switchgrass And Miscanthus RhizosphereLTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRGQGPAGW
Ga0206353_1055245413300020082Corn, Switchgrass And Miscanthus RhizosphereLTPLLLALGASLAWGVADFVGPLLGRTLGVLRIMFW
Ga0193699_1017552023300021363SoilLTPLLLALGASLAWGVADFVGPLLSRTLGVLRIMFWAQVGGLTGIAI
Ga0247664_105016013300024232SoilLTPLLLALGASIAWGVADFVGPLISRTWGTLRVMFWAQIG
Ga0247668_107517113300024331SoilLSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVLAIALAVAI
Ga0207929_111460123300025505Arctic Peat SoilLSSLFLALGASLAWGFADFFGPLVSRTLGSLRVLFWAQ
Ga0207692_1033941823300025898Corn, Switchgrass And Miscanthus RhizosphereLSPLLLALGASLAWGVGDFVGPLLSRMLGVLRVLFWVEVGGLAAIAVAV
Ga0207707_1061864023300025912Corn RhizosphereLSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVIAIALAVAIRGQGPAGWAVLFAILASLG
Ga0207693_1017231933300025915Corn, Switchgrass And Miscanthus RhizosphereLTPLLLALGASIAWGVADFVGPLISRTWGTLRVMFWAQIGGFAGI
Ga0207660_1078330713300025917Corn RhizosphereLSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGV
Ga0207649_1103341823300025920Corn RhizosphereLTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIG
Ga0207652_1074344923300025921Corn RhizosphereLTPLLLALGASLAWGVADFVGPLFSRTLGSIRVLFWAQVGGVAAIA
Ga0207664_1063954313300025929Agricultural SoilLTPLLLALGASLAWGVSDFFGPLVSRTLGSLRVLFWAQVGGCASIALAVAIHGRGPAG
Ga0207690_1035478813300025932Corn RhizosphereLTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAV
Ga0207665_1111613923300025939Corn, Switchgrass And Miscanthus RhizosphereLTPLLLALGASLAWGISDFVGPLFSRTLGILRVLFWGQLGG
Ga0207661_1051651913300025944Corn RhizosphereLTPLVLALGASLAWGVGDFFGPLISRTVGVLPVLMWAQIGGVASLAVAVAIRGQGP
Ga0207661_1070510023300025944Corn RhizosphereLTPLLLALGASLAWGVGDFFGPLISRTLGVLPVLLWAQVGGVASIAVAMA
Ga0207667_1061596913300025949Corn RhizosphereLSSLFLALGASLAWGFADFFGPLVSRTLGLLPVIFWAQVGGVIAIALAVAIR
Ga0207639_1194358813300026041Corn RhizosphereLTPLLLALGASLAWGVSDFVGPLVARAAGTLRVLFWAQIG
Ga0207708_1117500623300026075Corn, Switchgrass And Miscanthus RhizosphereVTAVLLALGASLAWGVADFVGPWQARTWGTLRVLLW
Ga0207648_1220886223300026089Miscanthus RhizosphereLTPLLLALGASLAWGVADFAGPLISRTLGTLRVLF
Ga0207698_1117973223300026142Corn RhizosphereMPALVSRRPTPLLLALSASLAWGVADFVGPVWARTLGTLRVLLWAQVGGV
Ga0209056_1059390323300026538SoilVSLLLALGASLAWGVADFAGPLKGRTLGALPVLLWA
Ga0209810_105788033300027773Surface SoilVSDTGALFLALGASLAWGVADFVGPLWGRTFGALRV
Ga0265338_1101755923300028800RhizosphereVNEVLLALGASLAWGVADFVGPWQGHALGALRVMLWSQVAGL
Ga0307312_1022673533300028828SoilVPAALLLALSASLAWGVTDFVGPWQGRAFGALRVMLWGQFGGVIAIAI
Ga0307289_1025394413300028875SoilLTPLLLALGASLAWGVADFVGPLLSRTLGLLRIMFWGQVGGLA
Ga0247826_1037216713300030336SoilVTAVLLALGASLVWGVADFVGPLQARTHGTLRVLMWVQVGGLT
Ga0265330_1016597313300031235RhizosphereLTPLLLALGASLAWGVADFVGPLVSRTLGMLPVLFWAQIGVVLALA
Ga0318538_1080562623300031546SoilLSALALALGASLAWGVADFVGPLWGRTWGALRVLLWA
Ga0318573_1003105313300031564SoilLSALLLALGASLAWGVADFVGPLWGRTWGALRVLL
Ga0318555_1021139213300031640SoilVNGLLLALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAIAVAIR
Ga0265314_1048649723300031711RhizosphereLSPLILALSASLTWGVADFVGPLRARTLGTLPVLLWAQVGGLVAI
Ga0318493_1069935513300031723SoilVNALLLALGASLAWGVADFVGPWQGRTLGALRVMLWGQIAGFTTLI
Ga0318554_1032465813300031765SoilLSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAVAVA
Ga0318547_1011459233300031781SoilLSALLLALGASLAWGVADFVGPLWGRTWGALRVLLWAELGGLAGIALAV
Ga0318552_1051014613300031782SoilLTPLLLALGASIAWGIADFAGPLISRTFGALRILFWAQVG
Ga0318552_1061229213300031782SoilVNGLALALGASLAWGVADFVGPWQGRTLGTLRVLRWA
Ga0318497_1002841213300031805SoilLSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIA
Ga0306925_1223905513300031890SoilLTALALALGASLAWGVADFVGPLWGRTWGALRVMFWAQVGGLAGIALAAVARGE
Ga0318522_1027388013300031894SoilLTALALALGASLAWGVADFVGPLWGRTWGALRVMFWAQVGGLAG
Ga0318551_1087532723300031896SoilVNGLLLALGASLAWGVADFVGPWQGRTLGALRVMFWAQVAGVSA
Ga0306921_1096351823300031912SoilVNALLLALGASLAWGVADFVGPWQGRTLGALRVMLWGQ
Ga0308175_10074532013300031938SoilLTPLLLALGASLAWGVGDFFGPLISRSVGVLPVLLWAQVGGVASLAV
Ga0308174_1157246413300031939SoilLTPLLLALGASLAWGVGDFFGPLISRSVGVLPVLLWAQVGGVASLAVAVAI
Ga0308176_1127714223300031996SoilLTPLFLALGASLAWGVGDFFGPLISRTVGVLPVLM
Ga0308176_1252798623300031996SoilLTPLLLALGASFAWGVGDFFGPLISRTLGVLPVLLWAQVGGVA
Ga0318562_1010814933300032008SoilVTGLLLALGASLAWGVADFAGPFQARTLGTFRVLLWAQ
Ga0318524_1070412913300032067SoilLTPLLLALGASIAWGIADFAGPLISRTFGALRILFWAQV
Ga0308173_1221896523300032074SoilVSSALLALGASVAWGFADVVGPLWARTRGTLRVLLWAQVGGV
Ga0307471_10433675923300032180Hardwood Forest SoilLNPLLLALGASLAWGVADFTGPLVSRTFGALRILFWAQVGGVIGIAIAVGARAEGPA
Ga0335082_1058573813300032782SoilLTPLLLALGASLAWGVADFVGPLVSRTLGSLPVLFWA
Ga0335081_1212692623300032892SoilVTSLLLALGASLAWGVADFVGPWQARALGSLRVMLWAQLAGAVAMCVV
Ga0335071_1003840913300032897SoilLSAFALALGASLAWGVADFVGPLWGRTWGALRVLLWAQVGGVVAIAIAVALRGQ
Ga0335084_1071998413300033004SoilLTALALALGASLAWGVADFVGPLWGRTWGALRVMLWAQLAGVAAIAVAVAIR
Ga0314868_018626_1_1173300033758PeatlandMSALALALGASLAWGVADFVGPLWGRTWGALRVMLWAQL
Ga0314862_0067023_1_1533300033803PeatlandLSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAVAVAI
Ga0314864_0075869_2_1423300033805PeatlandMSALALALGASLAWGVADFVGPLWGRTWGALRVLLWAQLAGVAAIAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.