NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096238

Metagenome Family F096238

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096238
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 51 residues
Representative Sequence MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEK
Number of Associated Samples 99
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.19 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.29 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.571 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(31.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.56%    β-sheet: 0.00%    Coil/Unstructured: 58.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF08031BBE 10.48
PF01925TauE 6.67
PF03466LysR_substrate 5.71
PF00908dTDP_sugar_isom 3.81
PF00903Glyoxalase 2.86
PF01243Putative_PNPOx 2.86
PF12773DZR 2.86
PF00753Lactamase_B 2.86
PF00211Guanylate_cyc 1.90
PF13424TPR_12 1.90
PF00561Abhydrolase_1 1.90
PF00989PAS 0.95
PF13191AAA_16 0.95
PF00497SBP_bac_3 0.95
PF13458Peripla_BP_6 0.95
PF03795YCII 0.95
PF12802MarR_2 0.95
PF01522Polysacc_deac_1 0.95
PF00392GntR 0.95
PF12146Hydrolase_4 0.95
PF04932Wzy_C 0.95
PF00528BPD_transp_1 0.95
PF01594AI-2E_transport 0.95
PF07719TPR_2 0.95
PF13231PMT_2 0.95
PF13343SBP_bac_6 0.95
PF01370Epimerase 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 10.48
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 6.67
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 3.81
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.90
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.95
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.95
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.95
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.57 %
UnclassifiedrootN/A11.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10408309All Organisms → cellular organisms → Bacteria → Proteobacteria1270Open in IMG/M
3300001431|F14TB_101435453All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300004025|Ga0055433_10013012All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300004480|Ga0062592_101750419All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005294|Ga0065705_10505381All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005332|Ga0066388_103884446All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium762Open in IMG/M
3300005436|Ga0070713_100970292All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium819Open in IMG/M
3300005438|Ga0070701_10461476Not Available817Open in IMG/M
3300005467|Ga0070706_101910082All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300005468|Ga0070707_101048541All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300005518|Ga0070699_100043715All Organisms → cellular organisms → Bacteria → Proteobacteria3877Open in IMG/M
3300005526|Ga0073909_10355073All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005549|Ga0070704_101877317All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005615|Ga0070702_101533549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium549Open in IMG/M
3300005617|Ga0068859_102947726All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium521Open in IMG/M
3300005713|Ga0066905_100925893All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium764Open in IMG/M
3300005875|Ga0075293_1022203All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium810Open in IMG/M
3300005985|Ga0081539_10475937All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006844|Ga0075428_102508067All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006845|Ga0075421_100956779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium973Open in IMG/M
3300006852|Ga0075433_10275396All Organisms → cellular organisms → Bacteria → Proteobacteria1491Open in IMG/M
3300006854|Ga0075425_100027988All Organisms → cellular organisms → Bacteria → Proteobacteria6237Open in IMG/M
3300006854|Ga0075425_101960397All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium655Open in IMG/M
3300009038|Ga0099829_10900740All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium734Open in IMG/M
3300009090|Ga0099827_11342610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300009147|Ga0114129_12281532All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300009162|Ga0075423_10258220All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300010047|Ga0126382_11244315All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300010047|Ga0126382_11879736Not Available566Open in IMG/M
3300010360|Ga0126372_10655579All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1017Open in IMG/M
3300010360|Ga0126372_12638627All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300010397|Ga0134124_11715281All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium661Open in IMG/M
3300010401|Ga0134121_12134496All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010403|Ga0134123_10198327All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1706Open in IMG/M
3300011443|Ga0137457_1343875All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300012096|Ga0137389_10067366All Organisms → cellular organisms → Bacteria2758Open in IMG/M
3300012199|Ga0137383_10116442Not Available1947Open in IMG/M
3300012201|Ga0137365_10111677Not Available2056Open in IMG/M
3300012202|Ga0137363_11090004All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium679Open in IMG/M
3300012203|Ga0137399_11223912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium632Open in IMG/M
3300012207|Ga0137381_11092627All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012225|Ga0137434_1007168All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300012350|Ga0137372_10194425Not Available1628Open in IMG/M
3300012355|Ga0137369_10018172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM39836707Open in IMG/M
3300012363|Ga0137390_10677719Not Available994Open in IMG/M
3300012929|Ga0137404_11230253All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium689Open in IMG/M
3300012930|Ga0137407_11832946All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012931|Ga0153915_12874146All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium562Open in IMG/M
3300012938|Ga0162651_100097984All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012948|Ga0126375_11275244All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium616Open in IMG/M
3300012975|Ga0134110_10161352Not Available929Open in IMG/M
3300014881|Ga0180094_1075792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria749Open in IMG/M
3300014968|Ga0157379_10975535Not Available807Open in IMG/M
3300015053|Ga0137405_1307410All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300015373|Ga0132257_103676083All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300015374|Ga0132255_104519703All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium590Open in IMG/M
3300017659|Ga0134083_10228000All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300017973|Ga0187780_10244646All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1256Open in IMG/M
3300018070|Ga0184631_10189996All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300018075|Ga0184632_10051976All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300018429|Ga0190272_12973931All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019377|Ga0190264_11232067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300019879|Ga0193723_1027877All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300019883|Ga0193725_1038990All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300019998|Ga0193710_1002406All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300021080|Ga0210382_10557521All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300021178|Ga0210408_10801152All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M
3300021560|Ga0126371_11491450All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium805Open in IMG/M
3300025160|Ga0209109_10378358All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05663Open in IMG/M
3300025521|Ga0210083_1011530All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300025549|Ga0210094_1008999All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300025551|Ga0210131_1006748All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300025904|Ga0207647_10095890All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1766Open in IMG/M
3300025906|Ga0207699_11089242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300025907|Ga0207645_10054130All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2563Open in IMG/M
3300025910|Ga0207684_10626621All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300025922|Ga0207646_10863232All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium804Open in IMG/M
3300025922|Ga0207646_11141656All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025922|Ga0207646_11783998All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300025923|Ga0207681_10883121All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium748Open in IMG/M
3300025961|Ga0207712_10134755All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1887Open in IMG/M
3300026118|Ga0207675_100750257Not Available987Open in IMG/M
3300026285|Ga0209438_1214724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300026304|Ga0209240_1164590All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium679Open in IMG/M
3300026326|Ga0209801_1146269Not Available999Open in IMG/M
3300026469|Ga0257169_1089739All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300027562|Ga0209735_1105807All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300027651|Ga0209217_1097044All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium845Open in IMG/M
3300027862|Ga0209701_10097621All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300027907|Ga0207428_10650696All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium756Open in IMG/M
3300028711|Ga0307293_10066404All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300028784|Ga0307282_10446875All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300028807|Ga0307305_10094238All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300028828|Ga0307312_10544091All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria767Open in IMG/M
(restricted) 3300031150|Ga0255311_1034716Not Available1053Open in IMG/M
(restricted) 3300031197|Ga0255310_10193241Not Available568Open in IMG/M
3300031740|Ga0307468_100858805All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium781Open in IMG/M
3300031740|Ga0307468_101836415All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300031744|Ga0306918_10438055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1020Open in IMG/M
3300031820|Ga0307473_11503810All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300032174|Ga0307470_11185483All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium619Open in IMG/M
3300032180|Ga0307471_100481064All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300033289|Ga0310914_10615497All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria979Open in IMG/M
3300033501|Ga0326732_1062401All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium611Open in IMG/M
3300033513|Ga0316628_100850652All Organisms → cellular organisms → Bacteria1205Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.76%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.90%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.95%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.95%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025521Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033501Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fractionEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1040830933300000891SoilMLERPLPRWLAWATDPEQLRRVPFLARSPLFTGLPHRLLARLATRFFEKVYHPGEI
F14TB_10143545313300001431SoilMLALHLPRWLAWATDPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKAYRPGDIVFHE
Ga0055433_1001301213300004025Natural And Restored WetlandsMSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARL
Ga0062592_10175041923300004480SoilMLERRLPRWLAWTIDPEQARRAPFLAHSPLFAGLPRRLLGRLSTRFLEK
Ga0065705_1050538113300005294Switchgrass RhizosphereMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATR
Ga0066388_10388444623300005332Tropical Forest SoilMLEQHLPRWLRWAEDSELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGE
Ga0070713_10097029233300005436Corn, Switchgrass And Miscanthus RhizosphereMFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLARLA
Ga0070701_1046147623300005438Corn, Switchgrass And Miscanthus RhizosphereMSERPLPRWLAWAADPEQLRRAPFLAHSPLFAGLPRRLLARLATRFFEKVY
Ga0070706_10191008213300005467Corn, Switchgrass And Miscanthus RhizosphereMLKRGLPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLG
Ga0070707_10104854123300005468Corn, Switchgrass And Miscanthus RhizosphereMPERRLPRWLAWTMDREQARRAPFLAHSPLFTGLPRRQLGRLATRFLEKAYSAGEVVFHEGD
Ga0070699_10004371533300005518Corn, Switchgrass And Miscanthus RhizosphereMLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG
Ga0073909_1035507323300005526Surface SoilMLALHLPRWLTWATDPERARRAPFLARSPLFAGLPRRLLARLATRFFE
Ga0070704_10187731713300005549Corn, Switchgrass And Miscanthus RhizosphereMRAMQERRLPRWLVWAIDREQARRAPFLGRSPLFAGLPRRLLGRLATRFLEKAYYPGELVFQEGDPGRA
Ga0070702_10153354923300005615Corn, Switchgrass And Miscanthus RhizosphereMLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATR
Ga0068859_10294772613300005617Switchgrass RhizosphereMSERPLPRWLAWAADSEQLRRTPFLAHSPLFAGLPRRLL
Ga0066905_10092589323300005713Tropical Forest SoilMLEQYLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGD
Ga0075293_102220313300005875Rice Paddy SoilMFDQPLPRWLGWATDPDQLRRTPFLASSPLFTGLPRRLLARLATRFFEK
Ga0081539_1047593713300005985Tabebuia Heterophylla RhizosphereVGAMFEHPLPGWLSWATDPEQARRAPFLSRSPLFAGLPRRLLGRLATRFFEKTYRAGDVI
Ga0075428_10250806713300006844Populus RhizosphereMRAMQERRLPRWLVWAIDREQARRAPFLGRSPLFAGLPRRLLGRLATRFLEKAYYP
Ga0075421_10095677923300006845Populus RhizosphereMRAMQERRLPRWLVWAIDRKQARRAPFLGRSPLFAGLPRRLLGR
Ga0075433_1027539613300006852Populus RhizosphereMLERRLPRWLAWTIDPEQARRAPFLAHSPLFAGLPRRLLGRLSTRFLEKDYAPGD
Ga0075425_10002798873300006854Populus RhizosphereMLERHLPRWLTWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPR
Ga0075425_10196039713300006854Populus RhizosphereMPLENLPRWLAWVADLKQARRVPFLAHSPLFVGLPRRHLARLATHFFEKAY
Ga0099829_1090074023300009038Vadose Zone SoilMLKWRLPRWLEWAMDREQARCAPFLAHSPLFAGLPRRLLGRLATRFLEKAYDAGEVVFHEGD
Ga0099827_1134261023300009090Vadose Zone SoilMLKRALPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAG
Ga0114129_1228153223300009147Populus RhizosphereMLEQRLPRWLTWAGDPERARRAPFLARSPLFAGLP
Ga0075423_1025822033300009162Populus RhizosphereMLEQRLPRWLTWAGDPERARRAPFLARSPLFAGLPRRLLARLATRFFEKAYRPGDI
Ga0126382_1124431523300010047Tropical Forest SoilMRAMLNGRLPRWLAWARDPEQARRVPFLSHAPLFGGLRRRMLGRLGTRFLEKAYRPGDLVFQEG
Ga0126382_1187973613300010047Tropical Forest SoilMAARRGRWLAWAQDPEHRRRVALLRASPVFAGLPRRLLGRLAV
Ga0126372_1065557913300010360Tropical Forest SoilMLEQHLPRWLRWAEDSELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGEI
Ga0126372_1263862723300010360Tropical Forest SoilMLEEHLPRWLRWAEDPELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGEI
Ga0134124_1171528113300010397Terrestrial SoilMFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKV
Ga0134121_1213449613300010401Terrestrial SoilMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGRLATRFFEKFYHAGDVIFEE
Ga0134123_1019832713300010403Terrestrial SoilMLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFH
Ga0137457_134387523300011443SoilMFEQPLPRWLAWAEDPEQARRAPFLARSPLFAGLPRRLLARLATRFFE
Ga0137389_1006736613300012096Vadose Zone SoilMLKRGLPGWLEWAMDREQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAG
Ga0137383_1011644213300012199Vadose Zone SoilMLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAG
Ga0137365_1011167713300012201Vadose Zone SoilMLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG
Ga0137363_1109000423300012202Vadose Zone SoilMLKRGLPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLGRL
Ga0137399_1122391213300012203Vadose Zone SoilMPERRLSRWLAWARDHEQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAGE
Ga0137381_1109262713300012207Vadose Zone SoilMFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEVVFEEGDPGRAL
Ga0137434_100716813300012225SoilMFEQPLPRWLAWAEDPEQARRATFLARSPLFAGLPRRLLARLATRFFEKVYHPGEVVFEE
Ga0137372_1019442513300012350Vadose Zone SoilMLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATR
Ga0137369_10018172103300012355Vadose Zone SoilMQERRLRQWLAWAMDREQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYDSGEVVF
Ga0137390_1067771913300012363Vadose Zone SoilMFEQPLPRWLAWATDPEQVRRAPFLSRSPLFTGLPRRLLARLSTRFFE
Ga0137404_1123025313300012929Vadose Zone SoilMPDRRLSRWLAWARDHEQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG
Ga0137407_1183294613300012930Vadose Zone SoilMFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLA
Ga0153915_1287414623300012931Freshwater WetlandsMFEQPLPRWLAWAADPEQLRRAPFLAGSPLFTGLPRRLLARL
Ga0162651_10009798423300012938SoilMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYH
Ga0126375_1127524423300012948Tropical Forest SoilMLEQYLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVFHEGD
Ga0134110_1016135213300012975Grasslands SoilMLKRGLPRWLEWTMDREQARRAPLLAHSPLFAGLP
Ga0180094_107579213300014881SoilMPDRRLRRWLAWAMDREQARRAPFLSHSPLFAGLPRRMLGR
Ga0157379_1097553523300014968Switchgrass RhizosphereMSERRLPGWLAWAADPEQLRRAPFLAHSPLFAGLP
Ga0137405_130741013300015053Vadose Zone SoilMLAQRLPRWLVWATDPEQARRAPFLARSPLFAGLPRRLL
Ga0132257_10367608313300015373Arabidopsis RhizosphereVGTMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGRLATRFFEKF
Ga0132255_10451970323300015374Arabidopsis RhizosphereMFEQPLPRWLGWAGDPEQMRRAPFLAGSPLFTGLPRRLLARLATRFFEKTYRRGEIVFE
Ga0134083_1022800023300017659Grasslands SoilMLEERLPRWLTWAGDPERARRAPFLARSPLFAGLPRRLLARLA
Ga0187780_1024464613300017973Tropical PeatlandMFERPVPRWLAWATDPEQLRRAPFLARSPLFSGLPRRLL
Ga0184631_1018999623300018070Groundwater SedimentMFELPLPRWLAWAADPEQQRRAPFLARSPLFAGLPRRLLARLATRFFEKVYRPGDIVF
Ga0184632_1005197633300018075Groundwater SedimentMFERPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATRFFEKV
Ga0190272_1297393113300018429SoilMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRLFEKVYHPGEIVFEAGDPGRAL
Ga0190264_1123206713300019377SoilMLERRLPRWLAWAIDREQARRAPFLAHSPLFAGLPRRLLGRLGTRFLEKCYSAGE
Ga0193723_102787713300019879SoilMFEPPLPRWLGWAADPEQLRRAPFLARSPLFAGLPRRLLGRLATR
Ga0193725_103899023300019883SoilMFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEIVFEE
Ga0193710_100240613300019998SoilMFERPLPRWLGWAADPEQLRRAPFLARSPLFAGLPRRLLGRLATRFFE
Ga0210382_1055752113300021080Groundwater SedimentMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEIVFEEGDPGR
Ga0210408_1080115223300021178SoilMAERPLPRWLAWAADPEQLRRAPFLARSPLFTGLPRRLLARLATRFFEKAYRPGEV
Ga0126371_1149145023300021560Tropical Forest SoilMLEQHLPRWLRWAEDPELARRAPFLARAPLFAGLPRRLLGRLAPRFF
Ga0209109_1037835823300025160SoilMLSGLPRWLGWVRDPEHVRRVTVLARAPVFAGLPRRLLGR
Ga0210083_101153013300025521Natural And Restored WetlandsMSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLA
Ga0210094_100899913300025549Natural And Restored WetlandsMSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLL
Ga0210131_100674813300025551Natural And Restored WetlandsMSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLAPRFFE
Ga0207647_1009589013300025904Corn RhizosphereMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGR
Ga0207699_1108924213300025906Corn, Switchgrass And Miscanthus RhizosphereMFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKVYHADDV
Ga0207645_1005413013300025907Miscanthus RhizosphereMFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGR
Ga0207684_1062662123300025910Corn, Switchgrass And Miscanthus RhizosphereVGAMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLL
Ga0207646_1086323213300025922Corn, Switchgrass And Miscanthus RhizosphereMPERRLPRWLAWTMDREQARRAPFLAHSPLFTGLPRRQLGRLATRFLEKAYSAGE
Ga0207646_1114165633300025922Corn, Switchgrass And Miscanthus RhizosphereMAERRLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATRFLEKVYR
Ga0207646_1178399813300025922Corn, Switchgrass And Miscanthus RhizosphereMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEVVFEEGDP
Ga0207681_1088312113300025923Switchgrass RhizosphereMFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKVYHPGEVIF
Ga0207712_1013475523300025961Switchgrass RhizosphereMFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKVYHPGEVIFEVGD
Ga0207675_10075025713300026118Switchgrass RhizosphereMSERRLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLGTRFLEKVYRPGEVV
Ga0209438_121472413300026285Grasslands SoilMFEQPLPRWLAWATDPEQVRRAPFLSSSPLFTGLPRRLLARLATRFFEKVYHP
Ga0209240_116459013300026304Grasslands SoilMFEQPLPRWLAWATDPEQVRRAPFLSRSPLFTGLPRRLLARLSTRFFEKAYHPGEVVFEEGDPGRA
Ga0209801_114626923300026326SoilMLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYS
Ga0257169_108973913300026469SoilMFEQPLPRWLAWATDPEQVRRAPFLSSSPLFTGLPRRLLARLSTRFFEKA
Ga0209735_110580713300027562Forest SoilMSERPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATR
Ga0209217_109704423300027651Forest SoilMFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEK
Ga0209701_1009762133300027862Vadose Zone SoilVRAVLKRGLPRWLEWAMDREQARRAPFLAHSPLFAG
Ga0207428_1065069623300027907Populus RhizosphereMALMHAMLERRLPRWLAWTIDPEQARRAPFLAHAPLFAGLPRRLLGRLSTRFLEKDYAPGDMVFHEGDP
Ga0307293_1006640413300028711SoilMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLL
Ga0307282_1044687523300028784SoilMFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLA
Ga0307305_1009423823300028807SoilMFEQPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRMLGRLATRFLEKAYYPGEFVFHE
Ga0307312_1054409123300028828SoilMLERRLPRWLAWAIDREQARRAPFLAHSPLFAGLPRRLLGRLGTRFLEK
(restricted) Ga0255311_103471613300031150Sandy SoilVLKRGLPRWLEWAMDREQAQRAPFLAHSPLFAGLPRRLLGR
(restricted) Ga0255310_1019324113300031197Sandy SoilMFERPLPRWLAWAADPEQLRRAPFLASAPLFAGLPRRLLARLAT
Ga0307468_10085880513300031740Hardwood Forest SoilMFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLA
Ga0307468_10183641523300031740Hardwood Forest SoilVNTLLERRLPRWLAWTIDPEQARRAPFLSHSPLFAGLPRRLLGRLATR
Ga0306918_1043805523300031744SoilMLEQHLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVFHEGDPGR
Ga0307473_1150381023300031820Hardwood Forest SoilMFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLARLATRFFEKVYHADD
Ga0307470_1118548333300032174Hardwood Forest SoilMFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKV
Ga0307471_10048106413300032180Hardwood Forest SoilMFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKVYHA
Ga0310914_1061549723300033289SoilMLEQHLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVF
Ga0326732_106240123300033501Peat SoilMSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLAPRFFEKTY
Ga0316628_10085065213300033513SoilMSDHPLPRWLAWAADPDQLRRTPFLASSPLFTGLPRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.