NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096268

Metagenome Family F096268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096268
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 47 residues
Representative Sequence PDGVVHLSTKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR
Number of Associated Samples 101
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.14 %
% of genes from short scaffolds (< 2000 bps) 91.43 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.429 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(28.571 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.22%    β-sheet: 44.44%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF09084NMT1 88.57
PF02771Acyl-CoA_dh_N 2.86
PF00378ECH_1 1.90
PF13378MR_MLE_C 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 88.57
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 88.57
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1174189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300000559|F14TC_101592964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300000956|JGI10216J12902_116967566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300001139|JGI10220J13317_10424120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300001372|YBBDRAFT_1187887All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300003987|Ga0055471_10051155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1118Open in IMG/M
3300003987|Ga0055471_10194699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300003999|Ga0055469_10309188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300004022|Ga0055432_10120822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300004479|Ga0062595_100330568All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1048Open in IMG/M
3300004643|Ga0062591_102418760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300004778|Ga0062383_10175289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium976Open in IMG/M
3300005336|Ga0070680_101225223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300005344|Ga0070661_101758711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300005434|Ga0070709_11063211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300005440|Ga0070705_101123935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300005450|Ga0066682_10417998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria856Open in IMG/M
3300005466|Ga0070685_10873290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300005556|Ga0066707_10975823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300005557|Ga0066704_10637338All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005615|Ga0070702_101272832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300005887|Ga0075292_1000112All Organisms → cellular organisms → Bacteria → Proteobacteria8415Open in IMG/M
3300006196|Ga0075422_10099475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300006797|Ga0066659_10281206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1261Open in IMG/M
3300006847|Ga0075431_101671371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300006854|Ga0075425_101424893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300006854|Ga0075425_101475385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300006894|Ga0079215_10079654All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300006903|Ga0075426_11139353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300006904|Ga0075424_100489896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1312Open in IMG/M
3300006969|Ga0075419_10998629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300007076|Ga0075435_100224191All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300009094|Ga0111539_10568848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1320Open in IMG/M
3300009098|Ga0105245_10771087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium998Open in IMG/M
3300009167|Ga0113563_11216090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300009171|Ga0105101_10263983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300009177|Ga0105248_13275062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300009609|Ga0105347_1190028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300010037|Ga0126304_10454057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium858Open in IMG/M
3300010046|Ga0126384_10959870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300010048|Ga0126373_10106209All Organisms → cellular organisms → Bacteria2605Open in IMG/M
3300010358|Ga0126370_12511571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300010391|Ga0136847_12708284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2191Open in IMG/M
3300010868|Ga0124844_1118599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1010Open in IMG/M
3300011416|Ga0137422_1152005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300011429|Ga0137455_1173189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300012041|Ga0137430_1068773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium976Open in IMG/M
3300012208|Ga0137376_10174878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1853Open in IMG/M
3300012212|Ga0150985_120360074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M
3300012532|Ga0137373_11174623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300012957|Ga0164303_10558484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300014254|Ga0075312_1003306All Organisms → cellular organisms → Bacteria → Proteobacteria2510Open in IMG/M
3300014264|Ga0075308_1052412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium798Open in IMG/M
3300014272|Ga0075327_1028458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1665Open in IMG/M
3300014298|Ga0075341_1106050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300014305|Ga0075349_1072558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300014324|Ga0075352_1230277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300014877|Ga0180074_1036020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1018Open in IMG/M
3300015201|Ga0173478_10083688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1136Open in IMG/M
3300015358|Ga0134089_10031612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1869Open in IMG/M
3300015358|Ga0134089_10467878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300015374|Ga0132255_100833559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1376Open in IMG/M
3300016357|Ga0182032_11196335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300018031|Ga0184634_10237744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium834Open in IMG/M
3300018053|Ga0184626_10076854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1409Open in IMG/M
3300018077|Ga0184633_10075627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1730Open in IMG/M
3300018084|Ga0184629_10521242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300018422|Ga0190265_12557755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300018466|Ga0190268_10101379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1339Open in IMG/M
3300019878|Ga0193715_1001987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4550Open in IMG/M
3300021560|Ga0126371_13793010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300025160|Ga0209109_10038684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2559Open in IMG/M
3300025167|Ga0209642_10745796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300025289|Ga0209002_10193709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1260Open in IMG/M
3300025327|Ga0209751_10839225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300025593|Ga0210096_1187403All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025796|Ga0210113_1102378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300025907|Ga0207645_10017772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4688Open in IMG/M
3300025922|Ga0207646_11920250All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025959|Ga0210116_1095295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300026088|Ga0207641_12062009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300026317|Ga0209154_1218509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300026329|Ga0209375_1228296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300026536|Ga0209058_1135230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1192Open in IMG/M
3300026537|Ga0209157_1068740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1785Open in IMG/M
3300027682|Ga0209971_1044119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1075Open in IMG/M
3300027691|Ga0209485_1031889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1273Open in IMG/M
3300027748|Ga0209689_1014523All Organisms → cellular organisms → Bacteria5057Open in IMG/M
3300027815|Ga0209726_10051070All Organisms → cellular organisms → Bacteria2873Open in IMG/M
3300027831|Ga0209797_10073269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1509Open in IMG/M
3300027907|Ga0207428_10364988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1061Open in IMG/M
3300027907|Ga0207428_10798464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300028379|Ga0268266_10216993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1757Open in IMG/M
3300030620|Ga0302046_11008279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
(restricted) 3300031197|Ga0255310_10184928All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300031198|Ga0307500_10096878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium787Open in IMG/M
3300031944|Ga0310884_10257470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300031962|Ga0307479_10905463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium854Open in IMG/M
3300031965|Ga0326597_10424565All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300032174|Ga0307470_10844713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300032205|Ga0307472_101576024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300032211|Ga0310896_10526634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300033811|Ga0364924_032537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1071Open in IMG/M
3300034178|Ga0364934_0266328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300034354|Ga0364943_0234414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.67%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands5.71%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.86%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.95%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.95%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.95%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.95%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014305Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025593Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_117418912228664022SoilEELLRESPHVTPDRIVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKQIR
F14TC_10159296423300000559SoilEELLRESPHVTPDGVVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKRIG*
JGI10216J12902_11696756623300000956SoilVHLSTKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKGIK*
JGI10220J13317_1042412013300001139SoilSPNVTPDGVVHLSTDAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIK*
YBBDRAFT_118788723300001372Marine EstuarineTPDGVVHLSTKAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKKIG*
Ga0055471_1005115523300003987Natural And Restored WetlandsNDDELLKESPNVTADQVVHLSSKPEDIMLIVCGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0055471_1019469923300003987Natural And Restored WetlandsTPDGVVHLATRAEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIE*
Ga0055469_1030918823300003999Natural And Restored WetlandsVVHLSSKPEDIMLIVCGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0055432_1012082223300004022Natural And Restored WetlandsPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKPIESMDS*
Ga0062595_10033056823300004479SoilELLKDAPHVTPDRVVHLSAKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKAIR*
Ga0062591_10241876023300004643SoilESINMTPDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIGR*
Ga0062383_1017528923300004778Wetland SedimentDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKGIK*
Ga0070680_10122522313300005336Corn RhizosphereTPDGVVHLSTNAQDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIR*
Ga0070661_10175871113300005344Corn RhizosphereVTPDKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0070709_1106321123300005434Corn, Switchgrass And Miscanthus RhizosphereLKDAPHVTPDMVVHLSSKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0070705_10112393513300005440Corn, Switchgrass And Miscanthus RhizosphereKSDDELLKDAPHVTPDRVVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0066682_1041799813300005450SoilNVTPDGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0070685_1087329013300005466Switchgrass RhizosphereKDAPHVTPDKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0066707_1097582323300005556SoilEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0066704_1063733813300005557SoilTPDGIVHLSIRPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0070702_10127283213300005615Corn, Switchgrass And Miscanthus RhizosphereLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0075292_100011293300005887Rice Paddy SoilEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKRVG*
Ga0075422_1009947523300006196Populus RhizospherePHVTPDRVVHLSSKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0066659_1028120613300006797SoilVHLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKQIR*
Ga0075431_10167137123300006847Populus RhizosphereVHLSSKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIS*
Ga0075425_10142489313300006854Populus RhizosphereDDELLKDAPHVTPDKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0075425_10147538523300006854Populus RhizosphereVTPDRVVHLSAKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKEIR*
Ga0079215_1007965413300006894Agricultural SoilTKAEDIMIVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0075426_1113935313300006903Populus RhizosphereTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKRIH*
Ga0075424_10048989613300006904Populus RhizosphereFRESPHVTPDGIVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKRIR*
Ga0075419_1099862913300006969Populus RhizosphereLMRESINLTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCAIKPIR*
Ga0075435_10022419133300007076Populus RhizospherePDRVVHLSAKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKEIR*
Ga0111539_1056884833300009094Populus RhizosphereDRVVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0105245_1077108713300009098Miscanthus RhizosphereHLSSKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIN*
Ga0113563_1121609023300009167Freshwater WetlandsLLRESPHVTPDGVVHLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCMIKTIRQKNEMLE*
Ga0105101_1026398323300009171Freshwater SedimentELLRESPNVTPDGVVHLSTAPEDIMVIVVGGKHRHSVFLPLWTGRNTLCVIKGIR*
Ga0105248_1327506223300009177Switchgrass RhizosphereDKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0105347_119002823300009609SoilRESINVTPDGVVHLSTKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0126304_1045405713300010037Serpentine SoilNMTPDGVVHLSTQPEDIMVIVVGGKHRHSVFLPMWTGRNTLCAMKGIK*
Ga0126384_1095987013300010046Tropical Forest SoilLSVRPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKKIG*
Ga0126373_1010620913300010048Tropical Forest SoilMTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIER*
Ga0126370_1251157123300010358Tropical Forest SoilDEELMRESINMTSDGVVHLSTKPEDIMVIVTGGKHRHSVFLPMWTGRNTLCVIKGIGR*
Ga0136847_1270828413300010391Freshwater SedimentEDIMVIVIGGKHRHSVFLPMWTGRNTLCAIKQIK*
Ga0124844_111859933300010868Tropical Forest SoilLTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIGR*
Ga0137422_115200523300011416SoilVTPDGIVHLSTKPEDIMVVVLGGKHRHSVLLPMWTGRNTLSVIKRIG*
Ga0137455_117318923300011429SoilAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKQIG*
Ga0137430_106877323300012041SoilPDGVVHLSTKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0137376_1017487813300012208Vadose Zone SoilDEELLRESPHVTPDGIVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKRIR*
Ga0150985_12036007423300012212Avena Fatua RhizosphereLRESPNVTPDGVVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIR*
Ga0137373_1117462313300012532Vadose Zone SoilRESPNVTPDGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0164303_1055848413300012957SoilKDAPHVTPDRVVHLSAKPEAIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0075312_100330633300014254Natural And Restored WetlandsSTKPEDIRVVVLGGKHRHSVFLPMWTGRNTLCVSKAIQ*
Ga0075308_105241213300014264Natural And Restored WetlandsLMRESINMTPDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIK*
Ga0075327_102845833300014272Natural And Restored WetlandsDGIVHLSVTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKRIG*
Ga0075341_110605013300014298Natural And Restored WetlandsLMRESINMTPDGLVHLSTKPEDIMVVVVGGKHRHSVFLPMWTGRNTLCVIKGIK*
Ga0075349_107255823300014305Natural And Restored WetlandsINMTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIESKS*
Ga0075352_123027713300014324Natural And Restored WetlandsHVTPDGVVHLSMKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKGIR*
Ga0180074_103602013300014877SoilLLKESPNVTPDQVVHLSTRPEDIMIIVCGGKHRHSVFLPMWTGRNTLCVTKQIE*
Ga0173478_1008368813300015201SoilTKAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIE*
Ga0134089_1003161213300015358Grasslands SoilDGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR*
Ga0134089_1046787813300015358Grasslands SoilAPHVTPDMVVHLSSKPEDIMIIVVGGKHRHSVFLPMWTGRNTLCVIKGIG*
Ga0132255_10083355933300015374Arabidopsis RhizospherePDRVVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR*
Ga0182032_1119633523300016357SoilVVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR
Ga0184634_1023774413300018031Groundwater SedimentKSEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0184626_1007685413300018053Groundwater SedimentTPDGVVHLSTTPEDIMVIVIGGKHRHSVFLPMWTGRNTLCAIKPIR
Ga0184633_1007562713300018077Groundwater SedimentHVTPDGVVHLSAKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKGIR
Ga0184629_1052124223300018084Groundwater SedimentLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKAIR
Ga0190265_1255775523300018422SoilPNVTADGVVHLSTKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIRGQLE
Ga0190268_1010137913300018466SoilHLSTKAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKQIG
Ga0193715_100198763300019878SoilTSDMVVHLSSKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0126371_1379301013300021560Tropical Forest SoilEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIER
Ga0209109_1003868443300025160SoilVTPDGVVHLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIG
Ga0209642_1074579613300025167SoilPDGVVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0209002_1019370923300025289SoilIRPEDIMAVVLGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0209751_1083922513300025327SoilTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIG
Ga0210096_118740323300025593Natural And Restored WetlandsVHLATTPDDIMVVVLGGKHRHSVLLPMWTGRNTLAVTKPIRPA
Ga0210113_110237823300025796Natural And Restored WetlandsKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKRVG
Ga0207645_1001777213300025907Miscanthus RhizosphereVHLSAEPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR
Ga0207646_1192025013300025922Corn, Switchgrass And Miscanthus RhizosphereESINMTPDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCAIKGIGK
Ga0210116_109529523300025959Natural And Restored WetlandsTPDGVVHLSTKAEDIMVIVIGGKHRHSVFLPMWTGRNTLCAIKGIGK
Ga0207641_1206200913300026088Switchgrass RhizosphereMVVHLSSKSEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIN
Ga0209154_121850923300026317SoilSDEELLRESPNVTPDGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR
Ga0209375_122829613300026329SoilPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR
Ga0209058_113523013300026536SoilGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR
Ga0209157_106874013300026537SoilLRESPNVTPDGIVHLSTTPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKPIR
Ga0209971_104411923300027682Arabidopsis Thaliana RhizosphereELLRESPNVTPDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIG
Ga0209485_103188913300027691Agricultural SoilVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIK
Ga0209689_101452353300027748SoilVTPDGIVHLSIRPEDIMVVVLGGKHRHSVFLPMCTGRNTLSVIKPIR
Ga0209726_1005107013300027815GroundwaterLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0209797_1007326913300027831Wetland SedimentSINMTPDGVVHLSTKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKGIGK
Ga0207428_1036498823300027907Populus RhizosphereKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKEIR
Ga0207428_1079846423300027907Populus RhizosphereLLKDAPHVTPDKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR
Ga0268266_1021699313300028379Switchgrass RhizospherePVKLVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR
Ga0302046_1100827913300030620SoilRESPNVTADGVVHLSTKPEDVMVIVAGGKHRHSVFLPMWTGRNTLCVIKGIR
(restricted) Ga0255310_1018492823300031197Sandy SoilLSTKAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIK
Ga0307500_1009687813300031198SoilDRVVHLSSKAEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIN
Ga0310884_1025747023300031944SoilDRVVHLSSKPEDIMVIVVGGKHRHSVFLPMWTGRNTLCVIKPIR
Ga0307479_1090546313300031962Hardwood Forest SoilVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKGIR
Ga0326597_1042456513300031965SoilATKPADIMVIVTGGKHRHSVFLPMWTGRNTLCAIKPIG
Ga0307470_1084471313300032174Hardwood Forest SoilRESPHVTPDGIVHLSTKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKQIR
Ga0307472_10157602413300032205Hardwood Forest SoilVHLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLSVIKQIR
Ga0310896_1052663413300032211SoilVTPDRVVHLSAKPEDIMVIVAGGKHRHSVFLPMWTGRNTLCVIKEIR
Ga0364924_032537_2_1813300033811SedimentKSDEELLRESPNVTPDGVVHLSIKPEDIMVVVLGGKHRHSVFLPMWTGRNTLCVIKGIR
Ga0364934_0266328_482_6433300034178SedimentMRESINMTPDGVVHLSTKPEDIMVIVIGGKHRHSVFLPMWTGRNTLCAIKPVR
Ga0364943_0234414_30_1913300034354SedimentMRESINMTPDGVVHLSTRAEDIMVIVIGGKHRHSVFLPMWTGRNTLCVIKQIG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.