NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096327

Metagenome Family F096327

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096327
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MKRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Number of Associated Samples 27
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 64.42 %
% of genes near scaffold ends (potentially truncated) 41.35 %
% of genes from short scaffolds (< 2000 bps) 38.46 %
Associated GOLD sequencing projects 27
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.385 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(48.077 % of family members)
Environment Ontology (ENVO) Unclassified
(99.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(88.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 8.33%    Coil/Unstructured: 91.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF05699Dimer_Tnp_hAT 1.92
PF13855LRR_8 1.92
PF07727RVT_2 1.92
PF08284RVP_2 1.92
PF14299PP2 0.96
PF00642zf-CCCH 0.96
PF02892zf-BED 0.96
PF01398JAB 0.96
PF08263LRRNT_2 0.96
PF00665rve 0.96
PF00806PUF 0.96
PF00005ABC_tran 0.96
PF00652Ricin_B_lectin 0.96
PF00675Peptidase_M16 0.96
PF02298Cu_bind_like 0.96
PF03732Retrotrans_gag 0.96
PF13839PC-Esterase 0.96
PF00999Na_H_Exchanger 0.96
PF03124EXS 0.96
PF00291PALP 0.96
PF05562WCOR413 0.96
PF13966zf-RVT 0.96
PF02458Transferase 0.96
PF00060Lig_chan 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0834ABC-type amino acid transport/signal transduction system, periplasmic component/domainSignal transduction mechanisms [T] 1.92
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.96
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.96
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.96
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.96
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.96
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.96
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.96
COG4584TransposaseMobilome: prophages, transposons [X] 0.96
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.35 %
UnclassifiedrootN/A8.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300018476|Ga0190274_13730325Not Available515Open in IMG/M
3300028786|Ga0307517_10001859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta34540Open in IMG/M
3300028786|Ga0307517_10106579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2166Open in IMG/M
3300028786|Ga0307517_10174670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1402Open in IMG/M
3300028786|Ga0307517_10177238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1384Open in IMG/M
3300028786|Ga0307517_10270890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana976Open in IMG/M
3300028786|Ga0307517_10281540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana947Open in IMG/M
3300028786|Ga0307517_10557323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana571Open in IMG/M
3300028794|Ga0307515_10010524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta17720Open in IMG/M
3300028794|Ga0307515_10015946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix dunnii13798Open in IMG/M
3300028794|Ga0307515_10059256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5490Open in IMG/M
3300028794|Ga0307515_10268965Not Available1428Open in IMG/M
3300030521|Ga0307511_10000854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida32429Open in IMG/M
3300030521|Ga0307511_10016983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6995Open in IMG/M
3300030521|Ga0307511_10243348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana874Open in IMG/M
3300030522|Ga0307512_10064424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2792Open in IMG/M
3300030522|Ga0307512_10153552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1369Open in IMG/M
3300030522|Ga0307512_10209515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1039Open in IMG/M
3300031456|Ga0307513_10010005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11959Open in IMG/M
3300031456|Ga0307513_10093576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3054Open in IMG/M
3300031456|Ga0307513_10131087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2452Open in IMG/M
3300031456|Ga0307513_10283796Not Available1431Open in IMG/M
3300031456|Ga0307513_10599712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana810Open in IMG/M
3300031456|Ga0307513_10671567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana742Open in IMG/M
3300031456|Ga0307513_10699162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana719Open in IMG/M
3300031507|Ga0307509_10040004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5101Open in IMG/M
3300031507|Ga0307509_10040866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5039Open in IMG/M
3300031507|Ga0307509_10045313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4744Open in IMG/M
3300031507|Ga0307509_10063443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3890Open in IMG/M
3300031507|Ga0307509_10120918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2596Open in IMG/M
3300031507|Ga0307509_10281599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1423Open in IMG/M
3300031507|Ga0307509_10732656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana654Open in IMG/M
3300031616|Ga0307508_10063581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3255Open in IMG/M
3300031616|Ga0307508_10133909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2081Open in IMG/M
3300031616|Ga0307508_10260655Not Available1328Open in IMG/M
3300031616|Ga0307508_10708830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana616Open in IMG/M
3300031649|Ga0307514_10008259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8883Open in IMG/M
3300031649|Ga0307514_10047583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3347Open in IMG/M
3300031649|Ga0307514_10185586Not Available1333Open in IMG/M
3300031649|Ga0307514_10217455Not Available1176Open in IMG/M
3300031649|Ga0307514_10233793Not Available1110Open in IMG/M
3300031649|Ga0307514_10426691Not Available663Open in IMG/M
3300031649|Ga0307514_10472333Not Available608Open in IMG/M
3300031649|Ga0307514_10523189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana556Open in IMG/M
3300031730|Ga0307516_10375768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1083Open in IMG/M
3300031730|Ga0307516_10721506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana655Open in IMG/M
3300031838|Ga0307518_10026284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4200Open in IMG/M
3300032354|Ga0325403_1009688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9186Open in IMG/M
3300032354|Ga0325403_1018862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana6319Open in IMG/M
3300032354|Ga0325403_1019296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana6229Open in IMG/M
3300032354|Ga0325403_1028736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4724Open in IMG/M
3300032354|Ga0325403_1031794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4378Open in IMG/M
3300032354|Ga0325403_1042264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3440Open in IMG/M
3300032355|Ga0325401_1002771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15723Open in IMG/M
3300032355|Ga0325401_1003158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14969Open in IMG/M
3300032355|Ga0325401_1004219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13496Open in IMG/M
3300032355|Ga0325401_1021021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae6079Open in IMG/M
3300032355|Ga0325401_1040308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3833Open in IMG/M
3300032355|Ga0325401_1080162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2029Open in IMG/M
3300032355|Ga0325401_1126288All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300032374|Ga0325400_1002695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae15721Open in IMG/M
3300032374|Ga0325400_1016085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7098Open in IMG/M
3300032374|Ga0325400_1034455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4500Open in IMG/M
3300032374|Ga0325400_1085473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2194Open in IMG/M
3300032374|Ga0325400_1281236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana616Open in IMG/M
3300032374|Ga0325400_1313969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana547Open in IMG/M
3300032389|Ga0325405_1002560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta18706Open in IMG/M
3300032389|Ga0325405_1004063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae15019Open in IMG/M
3300032389|Ga0325405_1008852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9932Open in IMG/M
3300032389|Ga0325405_1013030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7867Open in IMG/M
3300032389|Ga0325405_1042441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3031Open in IMG/M
3300032389|Ga0325405_1084910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1124Open in IMG/M
3300032390|Ga0325404_1000895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida30554Open in IMG/M
3300032390|Ga0325404_1003853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae16023Open in IMG/M
3300032390|Ga0325404_1004307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae15151Open in IMG/M
3300032390|Ga0325404_1023956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5201Open in IMG/M
3300032390|Ga0325404_1028956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4410Open in IMG/M
3300032390|Ga0325404_1051993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2341Open in IMG/M
3300032390|Ga0325404_1100398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana787Open in IMG/M
3300032735|Ga0325410_1114072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana615Open in IMG/M
3300032740|Ga0325411_1015319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7578Open in IMG/M
3300032740|Ga0325411_1031452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana4168Open in IMG/M
3300032740|Ga0325411_1036448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa3573Open in IMG/M
3300032740|Ga0325411_1098495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana727Open in IMG/M
3300033160|Ga0325402_1044307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3257Open in IMG/M
3300033179|Ga0307507_10049354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4079Open in IMG/M
3300033180|Ga0307510_10205740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1496Open in IMG/M
3300033180|Ga0307510_10350479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana926Open in IMG/M
3300033180|Ga0307510_10576055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana574Open in IMG/M
3300034389|Ga0325419_002778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa19737Open in IMG/M
3300034389|Ga0325419_003914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales16664Open in IMG/M
3300034389|Ga0325419_005194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus14383Open in IMG/M
3300034389|Ga0325419_008821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana10736Open in IMG/M
3300034389|Ga0325419_061713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1802Open in IMG/M
3300034688|Ga0325420_045692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2823Open in IMG/M
3300034688|Ga0325420_086920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1310Open in IMG/M
3300034688|Ga0325420_102847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1022Open in IMG/M
3300034689|Ga0325421_014607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6924Open in IMG/M
3300034689|Ga0325421_016668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6336Open in IMG/M
3300034689|Ga0325421_031163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3894Open in IMG/M
3300034778|Ga0325423_080391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana1177Open in IMG/M
3300034899|Ga0325407_047585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2698Open in IMG/M
3300034901|Ga0325409_039013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3348Open in IMG/M
3300034901|Ga0325409_044626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana2867Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza48.08%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem39.42%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0190274_1373032513300018476SoilMKLLKTSKMTAQGNSWVPYVQGSDEVVISPKKLDSVTVI
Ga0307517_10001859233300028786EctomycorrhizaMKRLKTSKMTTQRNSWVPYVQGSSGVVISKKKLDSVTVISRGEN
Ga0307517_1010657913300028786EctomycorrhizaMKRLKTSRMTAQGNNWVPYVQGSDGVMISPKKLDSVTVISRGEN
Ga0307517_1017467013300028786EctomycorrhizaVMKRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRWEN
Ga0307517_1017723813300028786EctomycorrhizaVMKQLKTSRTTAQGNSWVPYDQGSDEVVISPKKLDSVTVISQREN
Ga0307517_1027089023300028786EctomycorrhizaRMTAQGNSWVPYDQRFDEVVISPKKLDSVTVIFRREN
Ga0307517_1028154013300028786EctomycorrhizaKLLKTSKMTAQRNSWVLYVQGSDGVVISPKKLDSVTVISRREN
Ga0307517_1055732313300028786EctomycorrhizaMKRLKTSRTTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGKN
Ga0307515_1001052443300028794EctomycorrhizaMKQLKTSKTTAQGNSWVPYVQGSDGVVISPKKLDSVTVIS
Ga0307515_1001594613300028794EctomycorrhizaMKRWKTSKTAAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307515_1005925643300028794EctomycorrhizaMKRLKTSRMTAQGNSWVPYVQGSDGVVISSKKLDSVTVISQGEN
Ga0307515_1026896513300028794EctomycorrhizaMKRLKTSKTTAQRNSWVLYVQGSDGVVISPKKLDSVTVISR
Ga0307511_10000854283300030521EctomycorrhizaMKRLKTSKTMAKENSWVLYVQGSDRVVISPKKLDSVTVISRREN
Ga0307511_10016983113300030521EctomycorrhizaMKRLKTSKTTTQGNNWVPYVQGSDGVVISPKKLDSVTVISRREN
Ga0307511_1024334823300030521EctomycorrhizaLLKTSRMTAQRNSWVLYVQKSDGVVISPKKLDSVTVISRREN
Ga0307512_1006442423300030522EctomycorrhizaMKRLKTSKMTAQGSSWVPYVQGFDEVVISLKKLDLVTVIS
Ga0307512_1015355223300030522EctomycorrhizaRMAAQGDSWVPKVQGSDGVVISPKKLDSVTVISRGEN
Ga0307512_1020951513300030522EctomycorrhizaKTSKTTAQRNSWVPYVQGSDGVVISPKKLDSMTIISRWEN
Ga0307513_1001000573300031456EctomycorrhizaMTQRNSWVPYDQESDEVVISPKKLDSVTVISRREN
Ga0307513_1009357623300031456EctomycorrhizaMKQLKTSRTTAQGNNWVLYVQGSDGEVISPKKLDSVTVISRGEN
Ga0307513_1013108723300031456EctomycorrhizaMKRLKTNKITAQRNSWVSYVQGSDGVVISPKKLDSVTVISQREN
Ga0307513_1028379613300031456EctomycorrhizaMKRLKTSKTMAKENSWVLYVQGSDRVVISPKKLDSVT
Ga0307513_1059971213300031456EctomycorrhizaFVMKQLKTSRMAAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307513_1067156713300031456EctomycorrhizaSRMTTQRNNWVPYVQGSDGVMISPKKLDSATVISRGEN
Ga0307513_1069916213300031456EctomycorrhizaTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307509_1004000453300031507EctomycorrhizaMKQLKTSRMAAQGDSWVPKVQGSDGVVISPKKLDSVTVISRREN
Ga0307509_1004086613300031507EctomycorrhizaMKRLKTSKTTSQGNIWVPYVQGYDGVMISPKKLDSVTVISRGEN
Ga0307509_1004531343300031507EctomycorrhizaMEWLKTSKMTAEKNSWVPYIQGSDGVVISQKKLDSVTVIS
Ga0307509_1006344313300031507EctomycorrhizaIMKRLKISKTTTQENSWVPYVQGSDGVVISPKKLDSVTVISRREN
Ga0307509_1012091813300031507EctomycorrhizaMKRLKTSKMTAQGNSWVLYVQGYDGVVISPKKLDSVTVISRGEN
Ga0307509_1028159923300031507EctomycorrhizaVMKRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307509_1073265623300031507EctomycorrhizaKRLKTNKITAQRNSWVSYVQGSDGVVISPKKLDSVTVISQREN
Ga0307508_1006358113300031616EctomycorrhizaMKRLKTSRMTAQGNSWVPYDQRSDEVVISPKKLDSVTVISRREN
Ga0307508_1013390933300031616EctomycorrhizaVVDGDEKRLKTSRMTAQGNSWVPYVQGSDGVMISPKKLDS
Ga0307508_1026065513300031616EctomycorrhizaMKQLNTSKMTAQRYNYVQYVQGSDGVVISSKLDSMTVI
Ga0307508_1070883023300031616EctomycorrhizaVMKLLKTSKMTAQRNSWVPYVQGSNGVVISPKKLDSVTVIS
Ga0307514_1000825943300031649EctomycorrhizaMKLLKTSKMTAQKNSWVPYVQGSNGVVISPKKLDSITVISRGEN
Ga0307514_1004758343300031649EctomycorrhizaMTAQGNSWVPYIQGSDGVVISPKKLDSVIVISRGEN
Ga0307514_1018558633300031649EctomycorrhizaMKRLKTSRMTTQGNSWVPYDQGSDEVVISPKKLDSVTVISRGKN
Ga0307514_1021745523300031649EctomycorrhizaMKRLKTSRMTAQENSWVPYVQGSDEVVISPKKLASVTVISQGRIDEDPDNGR
Ga0307514_1023379313300031649EctomycorrhizaMKRLKTSRMTAQENSWVLYVQGSDGVVISPKRLDSMTMISRREK
Ga0307514_1042669113300031649EctomycorrhizaMKRLKTNKITAQRNSWVLYVQGSDGVVISLKKLDSVTVI
Ga0307514_1047233323300031649EctomycorrhizaMKRLKTSRMTAQGNSWVPKVQGSDEVVISPKKLDSVIVISRG
Ga0307514_1052318913300031649EctomycorrhizaKTSKMTAQGNSWVPYVQGSDGVVISPKRLDSVTVISRGEN
Ga0307516_1037576823300031730EctomycorrhizaVVVDGDEKRLKTSRMTAQGNSWVLYVQGSDGVMISPKKLDSVTVISRGEN
Ga0307516_1072150613300031730EctomycorrhizaKRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307518_1002628413300031838EctomycorrhizaMKRLKTSKTMAKENSWVLYVQGSDRVVISPKKLDSVTMISRREN
Ga0325403_100968853300032354XylemMKRLKTSRMTAQENSWILYDHESDEVVISPKKLDSVTVISRGEN
Ga0325403_101886233300032354XylemMKRLKTSKMTAQGNSWVPYDQGSDGVVISPKNLDSVIVISRGEN
Ga0325403_101929673300032354XylemMVLFSYIKQFVMKRLRTSNMTAQGNSWVPYIQGSDGVVISPKKLDSVIVISRGEN
Ga0325403_102873653300032354XylemMKRLKTNNMTAQENSWVLYVQGSDGVVISLKKLDSVTVISRGEK
Ga0325403_103179453300032354XylemMKRLKTSKTTAQRNNWVSYVQGSDGVVISPKKLDSVTVISQGEN
Ga0325403_104226423300032354XylemMKRLKTSKTTAQGNSWVPYDQGSDEVVISPKKLDSVTMISRWEN
Ga0325401_1002771103300032355XylemMERLKTSKMTAERNSWVLYIQGSDGVVISLKKLDSVTVISRREN
Ga0325401_1003158133300032355XylemMKRLKTSRMTAQGNSWVSYDQGSDEVVISPKKLDSVTVISRREN
Ga0325401_1004219153300032355XylemMKQLKASRMTAQGNSWVPKVQGSDGVVISSKKLDSVTVISRGEN
Ga0325401_102102153300032355XylemMKQLKTSRVTAQGNSWVPYVQGSDGVVISPKKLDSVIVISRGEN
Ga0325401_104030863300032355XylemMKWLKTSRMTTQRNSWVPYVQGSEEAVISPKKLDSVTVISRGEN
Ga0325401_108016223300032355XylemMKRLKTSRMTAQGNIWVPYDQRSDGVVISPKKLDSVTVISRGEN
Ga0325401_112628833300032355XylemLLKTSKMTAQRNSWVPYVQGSDGVVISPKKLDSVTVISRREN
Ga0325400_1002695103300032374XylemMERLKTSKMTAERNSWVLYIQGSDGVVISPKKLDSMTVISRREN
Ga0325400_101608553300032374XylemMKRLKTSKMTAQGNNWVSYDQGSNGVVISPKKLDSVTVIS
Ga0325400_103445513300032374XylemMKQLKTNRMAAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0325400_108547323300032374XylemMKRLKTSKTTAQRNSWVPYVQGSDGVVISPKKLDSVTVISQGEN
Ga0325400_128123613300032374XylemRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0325400_131396913300032374XylemMKRLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0325405_1002560133300032389XylemMKQLKTSRMTAQGNSWVPYVQGSDGVVISPKKLDSVIVISRGED
Ga0325405_1004063103300032389XylemMKRLKTSKTTAQSNSWVSYVQGFDGVVISPKKLDSVTVISRGEN
Ga0325405_1008852163300032389XylemMKWLKTSRMTAQGNSWVPYVQRSEEAVISPKKLDSVTVISRGEN
Ga0325405_101303043300032389XylemMTQRNSWVPYDQGSDGVVISQKKLDSVTIISRGEN
Ga0325405_104244123300032389XylemMKRLKTSKTTAQRNSWVPYVQGSDGVVISPKKLDSVTVISRGEN
Ga0325405_108491023300032389XylemTVLFSYIQQFVMKQLKTSRMAAQGNSWVPKVQGSDKVVISPNKLDSVTVISQGEN
Ga0325404_100089533300032390XylemMKQLKASRMTAQGNSWVPKVQGSDGVVISPKKLDSVTVISRGEN
Ga0325404_1003853213300032390XylemMKQLKTSRMAAQGNSWVPKVQGSDRVVISPKKLDSVTVISQGE
Ga0325404_100430743300032390XylemMAQRNSWIPYVQGYDGVVISPKKLDSVTKISRGEN
Ga0325404_102395663300032390XylemMKQLKTSKTTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRREN
Ga0325404_102895643300032390XylemMKQLKTSRMAAQGNSWVLYDQGSDEVVISPKKLDSVTVISRGKN
Ga0325404_105199313300032390XylemAAQGNSWVPKVQGSDRVVISPKKLDSVTVISQGEN
Ga0325404_110039833300032390XylemKTSKMTAQRNSWVPYVQGSDGVVISPKKLDSVTVISRREN
Ga0325410_111407233300032735XylemTAQRNSWVLYVQGSDGVVISPKMLDSVTVISRRDN
Ga0325411_101531913300032740XylemMMAQGNSWVPYDQGSDEVVISPKKLDSVIVISQGKN
Ga0325411_103145233300032740XylemMKQLKTSRMAAQGNSWVPKVQGSDRVVISPKKLDSVTVISQGEN
Ga0325411_103644823300032740XylemMKQLKTSRMAAQGNSWVLYDQGSDEVVISPKKLDSVTVISR
Ga0325411_109849513300032740XylemQLKTSRMAAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0325402_104430753300033160XylemMKQLKTSRTTAQGNSWVLYDQRSDEVVISPKKLDSVTVISRGEN
Ga0307507_1004935413300033179EctomycorrhizaMKRLKTSKTTSQGNSWVPYVQGYDGVMISPKKLDSVTVISRGEN
Ga0307510_1020574013300033180EctomycorrhizaMKQLKTSRMTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGEN
Ga0307510_1035047913300033180EctomycorrhizaFVMKQLKTSRMAAQGNSWVPKVQGSDGVVISPKKLDSVTVISRGEN
Ga0307510_1057605513300033180EctomycorrhizaVMKRLKTSRTTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRGKN
Ga0325419_002778_610_7443300034389LeafMKRLKTSKMTAQGNSWVPYDQGFDGVVISPKKLDSVTVISQGKN
Ga0325419_003914_1401_15353300034389LeafMKRLKTSRMTAQGNSWVPYDQGSDEVVISSKKLDSVTVISRGEN
Ga0325419_005194_11172_112823300034389LeafMMAQGNSWVPYVQGFDEVVISPKKLDSMTVISRWEN
Ga0325419_008821_6722_68503300034389LeafMKWLKTSKMTAQGNSWVPYVQGFDGVVISPKKLDSVTVISQG
Ga0325419_061713_1552_16863300034389LeafMKQLKTSRMAAQGNIWVPYDQRSDEVVISPKKLDSVTVISRWEN
Ga0325420_045692_577_6993300034688LeafMKRLKTSKMTAQGNNWVSYDQGSNGVVIFPKKLDSVTVIS
Ga0325420_086920_2_1393300034688LeafVMKQLKTSRMAAQGNSWVLYDQGSDEVVISPKKLDSVTVISRWEN
Ga0325420_102847_901_10203300034688LeafVSRMMAQGNSWVPKVQGSDGVVISPKKLDSMIVISRGEN
Ga0325421_014607_1623_17573300034689LeafMKRLKTSRMTAQGNSWVPYVQGSDGVVISPKKLDSVTVISQGEN
Ga0325421_016668_4891_50253300034689LeafMKWLKTSKMTAQENSWVPYIQGSNEVMISPKKLDSVTVISQGEN
Ga0325421_031163_2_1063300034689LeafMAAQGNSWVPKVQGSDRVVISPKKLDSVTVISQGE
Ga0325423_080391_121_2553300034778LeafMKQLKTSRMAAQGNGWVPYDQGSDEVVISPKKLDSVTVISRREN
Ga0325407_047585_1267_14013300034899XylemMKRLKTSRMTAQGNSWVPYVQGSDGVMISPKKLDSVIVFSQGEN
Ga0325409_039013_3063_31973300034901XylemMKRLKTSKTMAQRNSWVPYVQGSDGVVISPKKVDSVTVISRGEN
Ga0325409_044626_1361_14953300034901XylemMKQLKTSKTTAQGNSWVPYDQGSDEVVISPKKLDSVTVISRWEN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.