NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096428

Metagenome Family F096428

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096428
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 67 residues
Representative Sequence MRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPVSPRWCPN
Number of Associated Samples 70
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.12 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 64
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.885 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(67.308 % of family members)
Environment Ontology (ENVO) Unclassified
(92.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(69.231 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 24.44%    β-sheet: 0.00%    Coil/Unstructured: 75.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF04392ABC_sub_bind 2.88
PF08450SGL 1.92
PF00027cNMP_binding 0.96
PF01381HTH_3 0.96
PF13565HTH_32 0.96
PF13767DUF4168 0.96
PF08734GYD 0.96
PF02586SRAP 0.96
PF07369DUF1488 0.96
PF13455MUG113 0.96
PF12762DDE_Tnp_IS1595 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.88
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.92
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.92
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.96
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.88 %
UnclassifiedrootN/A22.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005764|Ga0066903_103561545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium839Open in IMG/M
3300009792|Ga0126374_10132509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii1479Open in IMG/M
3300010358|Ga0126370_10287015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d1297Open in IMG/M
3300016294|Ga0182041_10513240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1041Open in IMG/M
3300016294|Ga0182041_11078243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300016319|Ga0182033_10086605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2262Open in IMG/M
3300016319|Ga0182033_10878184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium793Open in IMG/M
3300016357|Ga0182032_10038109Not Available3012Open in IMG/M
3300016387|Ga0182040_10078297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2170Open in IMG/M
3300016387|Ga0182040_10171126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1570Open in IMG/M
3300016387|Ga0182040_10628856Not Available872Open in IMG/M
3300016387|Ga0182040_11665635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300016404|Ga0182037_10147172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1770Open in IMG/M
3300016404|Ga0182037_10161877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1699Open in IMG/M
3300016404|Ga0182037_11323018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300016422|Ga0182039_10535489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1016Open in IMG/M
3300016445|Ga0182038_10508566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1028Open in IMG/M
3300020581|Ga0210399_10534494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Aliidongia → Aliidongia dinghuensis973Open in IMG/M
3300021560|Ga0126371_11297064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium862Open in IMG/M
3300031231|Ga0170824_104094212Not Available638Open in IMG/M
3300031543|Ga0318516_10741303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031546|Ga0318538_10310374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium850Open in IMG/M
3300031564|Ga0318573_10335417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300031573|Ga0310915_10182945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-61460Open in IMG/M
3300031640|Ga0318555_10346233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria805Open in IMG/M
3300031640|Ga0318555_10563680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300031679|Ga0318561_10794335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300031681|Ga0318572_10018572All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans3450Open in IMG/M
3300031682|Ga0318560_10091403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1564Open in IMG/M
3300031719|Ga0306917_10980157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300031724|Ga0318500_10140562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1130Open in IMG/M
3300031736|Ga0318501_10111460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1376Open in IMG/M
3300031744|Ga0306918_10394133Not Available1078Open in IMG/M
3300031744|Ga0306918_10506298Not Available945Open in IMG/M
3300031744|Ga0306918_11097593Not Available616Open in IMG/M
3300031744|Ga0306918_11205022Not Available584Open in IMG/M
3300031747|Ga0318502_10309272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium930Open in IMG/M
3300031747|Ga0318502_10382524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium836Open in IMG/M
3300031747|Ga0318502_10940860Not Available526Open in IMG/M
3300031748|Ga0318492_10350907Not Available772Open in IMG/M
3300031751|Ga0318494_10103021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1575Open in IMG/M
3300031754|Ga0307475_10055152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2998Open in IMG/M
3300031754|Ga0307475_10253389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1410Open in IMG/M
3300031763|Ga0318537_10152585Not Available860Open in IMG/M
3300031765|Ga0318554_10073923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1892Open in IMG/M
3300031768|Ga0318509_10232531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1028Open in IMG/M
3300031768|Ga0318509_10743567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300031770|Ga0318521_10113230All Organisms → cellular organisms → Bacteria → Proteobacteria1508Open in IMG/M
3300031770|Ga0318521_10922900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300031781|Ga0318547_10170673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-61288Open in IMG/M
3300031781|Ga0318547_10413978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300031793|Ga0318548_10506100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300031797|Ga0318550_10055546All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans1790Open in IMG/M
3300031798|Ga0318523_10416819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300031819|Ga0318568_10461993Not Available791Open in IMG/M
3300031821|Ga0318567_10323950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300031821|Ga0318567_10606482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300031821|Ga0318567_10771895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031832|Ga0318499_10074530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1294Open in IMG/M
3300031845|Ga0318511_10623511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300031879|Ga0306919_10102077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2020Open in IMG/M
3300031890|Ga0306925_10989446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium858Open in IMG/M
3300031890|Ga0306925_11892870Not Available567Open in IMG/M
3300031893|Ga0318536_10268778Not Available866Open in IMG/M
3300031896|Ga0318551_10202290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1099Open in IMG/M
3300031896|Ga0318551_10381502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium800Open in IMG/M
3300031896|Ga0318551_10738631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300031897|Ga0318520_10168755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1278Open in IMG/M
3300031897|Ga0318520_10235371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1089Open in IMG/M
3300031897|Ga0318520_10246353Not Available1065Open in IMG/M
3300031912|Ga0306921_10335894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1767Open in IMG/M
3300031941|Ga0310912_10004279All Organisms → cellular organisms → Bacteria → Proteobacteria8463Open in IMG/M
3300031942|Ga0310916_10207164All Organisms → cellular organisms → Bacteria → Proteobacteria1643Open in IMG/M
3300031945|Ga0310913_10393128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium983Open in IMG/M
3300031947|Ga0310909_10200338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY11659Open in IMG/M
3300031947|Ga0310909_10682128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300031954|Ga0306926_11486500Not Available782Open in IMG/M
3300031959|Ga0318530_10144108Not Available965Open in IMG/M
3300031959|Ga0318530_10154197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium934Open in IMG/M
3300032001|Ga0306922_11387415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium707Open in IMG/M
3300032008|Ga0318562_10848490Not Available522Open in IMG/M
3300032010|Ga0318569_10094920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1343Open in IMG/M
3300032025|Ga0318507_10433280Not Available572Open in IMG/M
3300032039|Ga0318559_10529286Not Available550Open in IMG/M
3300032042|Ga0318545_10102190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1004Open in IMG/M
3300032054|Ga0318570_10389596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300032054|Ga0318570_10602309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300032059|Ga0318533_10064368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2472Open in IMG/M
3300032059|Ga0318533_10887258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300032060|Ga0318505_10284211Not Available780Open in IMG/M
3300032063|Ga0318504_10383288Not Available669Open in IMG/M
3300032064|Ga0318510_10217694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300032065|Ga0318513_10312935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300032076|Ga0306924_11182682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300032076|Ga0306924_12331681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales542Open in IMG/M
3300032090|Ga0318518_10330525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria782Open in IMG/M
3300032091|Ga0318577_10204562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium944Open in IMG/M
3300032094|Ga0318540_10387244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300033289|Ga0310914_10432954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1190Open in IMG/M
3300033289|Ga0310914_10601724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium991Open in IMG/M
3300033289|Ga0310914_10898381Not Available785Open in IMG/M
3300033289|Ga0310914_11115396Not Available690Open in IMG/M
3300033289|Ga0310914_11773763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300033289|Ga0310914_11829363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil67.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066903_10356154533300005764Tropical Forest SoilMRVLGLVLAGALALTASIGVQAGSLGPGSYTMPNGWNGDWRQAPSPSRQWNGGSVSRHWGSNGPSG
Ga0126374_1013250913300009792Tropical Forest SoilMRFLGLVLAGALALTAPTAVEGGSLDPGYYPMPNGWNGDWRRAPSPSRQWNGGSVLQRWW
Ga0126370_1028701523300010358Tropical Forest SoilMRVLGWVLAGALALTASIGVQAGSLGPGYYPMPNGWNGDWRRVPGPSHQWKGAGPSRWVPNALSGG*
Ga0182041_1051324013300016294SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWHRAPGPSRQWNGGPVSPR
Ga0182041_1107824323300016294SoilMRILGWILAGALALTVSIGAQAGSLGPGYYPMPNGWDGDWRRAPGPSRQWNGGPVSQRWCPNC
Ga0182033_1008660553300016319SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVPSPSPQWNGGSVSRRWWPNGPPGWWACCLGP
Ga0182033_1087818413300016319SoilMRVLGWVLAGALALTASTGVQAGSLGPGTYSMPNGWNGDWRRVPSPSRQWNGGSVSRRGWPNGPPGEGDQGLVPIFGDHSGFL
Ga0182032_1003810983300016357SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPAFH
Ga0182040_1007829713300016387SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQWNGGPVSPRWCPNCPPGGW
Ga0182040_1017112613300016387SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQWNGGPVSPRWCPNCPPGGW
Ga0182040_1062885623300016387SoilMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNRDWRRAPGPSRQWNGRWVSRHWGPN
Ga0182040_1166563513300016387SoilMEAPQETYMRVLGWVLAGALALTASVGVQAGSLGPGYYPMPNGWNGDWRRVPGPSHQWKGAGPSRWVPNALL
Ga0182037_1014717213300016404SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRGPAHSHQPNGGRVSPRWATNCPPGGWVPYGGP
Ga0182037_1016187713300016404SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVPSPSPQWNGGSVSRRWWPNGPPG
Ga0182037_1132301813300016404SoilMRVLGLVLAGALALTAPTAVQAASLGPSWYPMPNGWDGDWRRAPHPSHQWNGGPVSPRWCQNCPP
Ga0182039_1053548913300016422SoilMRVLGLILAGALALTAVTAVQAGSLGPGYHPMPNGWDGDWRRALGPSRQWNGGPV
Ga0182038_1050856613300016445SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWHRAPGPSRQWNGGPVSPRWWSS
Ga0210399_1053449413300020581SoilMRVLGWVLAGALALTAPIEVQAGSLGPAWYPMPNGWNGDWRRAPSPARPWNGGSVSRRWWPNGPPGARAC
Ga0126371_1129706413300021560Tropical Forest SoilMRVLGWVLAGALALTASIGVQAGSLGAGYYPMPNGWNGDWRRVSGPPRQWKGGGSVAL
Ga0170824_10409421213300031231Forest SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRQAPSPSRQWNGGSVSRRWWPNGPPGARACCPGPG
Ga0318516_1074130323300031543SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRSCPNCSGGWA
Ga0318538_1031037413300031546SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQRNGGPVSPRWCSNCPPGGWVPYGGPG
Ga0318573_1033541723300031564SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPVSPRWCPN
Ga0310915_1018294513300031573SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWGPN
Ga0318555_1034623323300031640SoilMRVLGLVLAGVLALTAAVGVQAGSLGPGWYPMPNGWDGDWRRTPGPSRQWNGGPVSPRWVPN
Ga0318555_1056368013300031640SoilMRVFGLVLAGALTLTAPIGIQAGSLGPGSYTMPNGWDGDWHRAPSPSRQWNSGPVSPRWCSNCPPGRWVCCPGPG
Ga0318561_1079433513300031679SoilMRVLGWVLAGALALITSIGVQAGSLGPGYHPMPNGWNDDWRRAPSSSPQWNGGPVSPHWVHNGPSGWWACCAARGVP
Ga0318572_1001857223300031681SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWGPNGPPGGWCPCVVQGVPTYW
Ga0318560_1009140313300031682SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPASPRWCPN
Ga0306917_1098015713300031719SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDWRRVPGPSRQWNGGPVSRHWGWNRPPGGW
Ga0318500_1014056233300031724SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPGPSRQWNGGPV
Ga0318501_1011146023300031736SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPAGGWCPC
Ga0306918_1039413333300031744SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDSRRVPGPSRQWNGGWVSRRWWPL
Ga0306918_1050629813300031744SoilMRFLGLVLAGALALTATTAVQAGSLGPGWYPMPNGWDGDWRRAPSPTRQSNGGPVS
Ga0306918_1109759313300031744SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQWNRGPVSPHWV
Ga0306918_1120502223300031744SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPASPRWCPNCLPG
Ga0318502_1030927213300031747SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSPSRQWNGGSVSPRWCSNCPP
Ga0318502_1038252413300031747SoilMRVLGWVLAGALALTASIGVQAGSLVPGWYPMPNGWDGDWRRAPSPSRQWNGGPASPRWCPNCLPGG
Ga0318502_1094086013300031747SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPGPSRRWNGGPVSPHWCPNCPSG
Ga0318492_1035090713300031748SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQWNRGPVSPHWVHNGPSGW
Ga0318494_1010302133300031751SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQRNGGPVSPRWCSNCPPGGWVPYGGPGVPTYWVY
Ga0307475_1005515263300031754Hardwood Forest SoilMRVLGLVLAGALALTAPIAPQAGSLGPGWYPMSNGWDGDWRRAPGPSRQWNGGPVSPRWCLNCPPGGWGPYSA
Ga0307475_1025338943300031754Hardwood Forest SoilMRVLGLVLAGALALAASVGVQAGSLGPGSYSMPNGWDGDWHRAAGPSRQWNGGPVSPR
Ga0318537_1015258523300031763SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQWNGGPVSPRW
Ga0318554_1007392313300031765SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNGRWVSRHWGPNGPPGG
Ga0318509_1023253113300031768SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPAGGW
Ga0318509_1074356713300031768SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWHRAPGPSRQWNGGPVS
Ga0318521_1011323013300031770SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWGPNGPPGGWCPCVVQGVPT
Ga0318521_1092290013300031770SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRAPGPSRQWNGGPVSQRWCPNCPAGGSACCPGAGVPTY
Ga0318547_1017067313300031781SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWG
Ga0318547_1041397813300031781SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRSCPNCSGGRACCSGTGV
Ga0318548_1050610013300031793SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRS
Ga0318550_1005554633300031797SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVSRHWGPNGPPGGWCPCVVQGVPTYWV
Ga0318523_1041681923300031798SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRSCPNCSGGRACCS
Ga0318568_1046199313300031819SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDWRRVPGPSRQWNGGPVSRHWGWNRPPGGWCPCVVQGVPTY
Ga0318567_1032395033300031821SoilMRVLGWVLAGALALTASIGVRAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPVS
Ga0318567_1060648213300031821SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSN
Ga0318567_1077189523300031821SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVPSPSPQWNGGSVSRRWWPNGPPGWWACCLGPSVPTYWVWGP
Ga0318499_1007453013300031832SoilMRVLGLVLAGALALTAPIGVQAGSLGPGSYSMPNGWDGDWHRAPGPSRQWNGGPVSPRWCPNC
Ga0318511_1062351113300031845SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRSC
Ga0306919_1010207713300031879SoilMRILGWILAGALALTVSIGAQAGSLGPGYYPMPNGWDGDWRRAPGPSRQWNGGPVSQRWCPN
Ga0306925_1098944613300031890SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPASPRWC
Ga0306925_1189287023300031890SoilMRVLGLALAGALALTASIAVQAGSLGPGYYPMPNGWNGDWRRAPGPSGQWNGAPVSHHWVPNGPSG
Ga0318536_1026877823300031893SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNGRWVSRHWGPNGPPGGWCPCVVQGVPT
Ga0318551_1020229013300031896SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDGDWRRAPSPSRQWNGGPASPRWCPNCLPGGWACCPGPGVPTYWV
Ga0318551_1038150223300031896SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWHRAPGPSRQWNGGP
Ga0318551_1073863113300031896SoilMRILGWILAGALALTVSIGAQAGSLGPGYYPMPNGWDGDWRRAPGPSRQWNGGPVSQRWCPNCPAGGSACCP
Ga0318520_1016875513300031897SoilMRFLGLVLAGALALTATTAVQARSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPISPRSCPNCSGGWA
Ga0318520_1023537113300031897SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPAGGWC
Ga0318520_1024635333300031897SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPGPSRRWNGGPVSPRWCPNCPSGG
Ga0306921_1033589443300031912SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNGRWVSRHWGPNGPPGGWCPCVVQGVPTY
Ga0310912_1000427913300031941SoilMRILGWILAGALALTVSIGAQAGSLGPGYYPMPNGWDGDWRRAPGPSRQWNGGPVSQ
Ga0310916_1020716433300031942SoilMRILGLVLSGVLALNATIGVQAGSLGPGWYPMPNGWNGDWRRAPGPSRQWNGGPFSRRWWPN
Ga0310913_1039312833300031945SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPPG
Ga0310909_1020033843300031947SoilMRVLGLVLAGALALTAPIGGYAGSLGPGSYSMPNGWDGDWRRAPGPSRQWNGGPVSPRWCPNCPSG
Ga0310909_1068212813300031947SoilMRVLGLVLAGALALTAPTGVHAGSLGPGSYSMPNGWNGDWRRAPGPSRQWNGGPVSPRWCSNCPPGGWGPYGGPG
Ga0306926_1148650023300031954SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDSRRVPGPSRQWNGGWVSRRWWPLA
Ga0318530_1014410813300031959SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPGPSRRWNGGPVSPHWCLNC
Ga0318530_1015419723300031959SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQRNGGPVSPRWCSNCPPGGWVPYGGPGVPTYWVYVP
Ga0306922_1138741513300032001SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDWRRVPGPSRQWNGGPVSRHWG
Ga0318562_1084849023300032008SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPGPSRRWNGGPVSPRWCPN
Ga0318569_1009492013300032010SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSPSRQWNGGSVSPRWCSNCPPGGWGSFAGPG
Ga0318507_1043328023300032025SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQWNGGPVS
Ga0318559_1052928613300032039SoilMRVLGLVLAGVLALTAAVGVQAGSLGPGWYPMPNGWDGDWRRAPGPSRQWNSGPVSPRWC
Ga0318545_1010219023300032042SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQRNGGPVSPRWCSNCPPGGWVPYGGPGVPTYWVYVPG
Ga0318570_1038959613300032054SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPPGGWCPCVVQ
Ga0318570_1060230923300032054SoilMRFLGLVLAGALALTATTAVQARSLGPGSYPMPNGWDGDWRRAPAPTRQWNGGPVSP
Ga0318533_1006436813300032059SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPVSRHWGSNGPPGGWCPCVVQGVPTYW
Ga0318533_1088725813300032059SoilMRVLGLVLAGALALTAPTAVQAASLGPSWYPMPNGWDGDWRRAPSPARQSNGRPVSPRRCQNCPPGGWGPK
Ga0318505_1028421133300032060SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPGPSRRWNGGPVSPHW
Ga0318504_1038328823300032063SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQWNRGPVSPHWVHNGPSGWWACCPARGVPTY
Ga0318510_1021769413300032064SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSPSRQWNGGSVSPRWCSNCPPGGWGSFAGPGVPTYWVWG
Ga0318513_1031293523300032065SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSPSRQWNGGSVSPRWCSNCPPGGWGSFAGPGVPTYWV
Ga0306924_1118268223300032076SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNGRWVSRHWGPNG
Ga0306924_1233168113300032076SoilMRVLGLVLAGALVLTASIGVQAGSLGPGWYPMPNGWDGDWRRAPGPSRQWNSGPVSPRWCPNCSPGGWACCPAPGV
Ga0318518_1033052513300032090SoilMRVLRLVLAGVLALTAAVGVQAGSLGPGWYPMPNGWDGDWRRTPGPSRQWNGGPVSPRWV
Ga0318577_1020456213300032091SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSPSRQWNGGSVSPRWCSNCPPGGWGSFA
Ga0318540_1038724413300032094SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGPV
Ga0310914_1043295433300033289SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNGRWVSRHWGPNGPPGGWCPCVVQGVP
Ga0310914_1060172423300033289SoilMRVFGLVLAGALTLTAPIGIQAGSLGPGSYTMPNGWDGDWHRAPSPSRQWNSGPVSPRWCSNCPPGRWV
Ga0310914_1089838113300033289SoilMRVLGLALAGALALTASIAVQAGSLGPGYYPMPNGWNGDWRRAPGPSGQSNGAPVSRHWVPNGPSGAGGCCP
Ga0310914_1111539623300033289SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDSRRVPGPSRQWNGGWVSRRWWPLAGW
Ga0310914_1177376323300033289SoilMRVLGLVLAGALALTAPTAVQAASLGPSWYPMPNGWDGDWRRAPSPARQSNGRPVSPRRCQNCPPGGWGPKS
Ga0310914_1182936323300033289SoilMEAPQETYMRVLGWVLAGALVLTASIGVQVGSLGPGYYPMPNGWNGDWRRVPGPSHQWKGAGPSRWVPNALLGGCCPSPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.