Basic Information | |
---|---|
Family ID | F096766 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 43 residues |
Representative Sequence | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 73.08 % |
% of genes near scaffold ends (potentially truncated) | 42.31 % |
% of genes from short scaffolds (< 2000 bps) | 75.96 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (37.500 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (28.846 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.538 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.231 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF10614 | CsgF | 39.42 |
PF03783 | CsgG | 14.42 |
PF14236 | DUF4338 | 5.77 |
PF04773 | FecR | 0.96 |
PF00149 | Metallophos | 0.96 |
PF00534 | Glycos_transf_1 | 0.96 |
PF13450 | NAD_binding_8 | 0.96 |
PF05226 | CHASE2 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 14.42 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.27 % |
Unclassified | root | N/A | 31.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199790089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2159 | Open in IMG/M |
2199352004|2199802028 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
3300001266|B570J13884_100052 | Not Available | 13904 | Open in IMG/M |
3300001266|B570J13884_105739 | Not Available | 783 | Open in IMG/M |
3300001282|B570J14230_10097619 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300002408|B570J29032_108750531 | Not Available | 502 | Open in IMG/M |
3300002408|B570J29032_109548493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
3300002835|B570J40625_100013548 | Not Available | 14474 | Open in IMG/M |
3300003429|JGI25914J50564_10034321 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
3300003986|Ga0063233_10023567 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
3300004096|Ga0066177_10578859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300005517|Ga0070374_10036532 | Not Available | 2545 | Open in IMG/M |
3300005517|Ga0070374_10421740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300005581|Ga0049081_10028458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2122 | Open in IMG/M |
3300005581|Ga0049081_10069275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
3300005662|Ga0078894_10610504 | Not Available | 970 | Open in IMG/M |
3300006875|Ga0075473_10373170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 577 | Open in IMG/M |
3300007545|Ga0102873_1055121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1213 | Open in IMG/M |
3300007546|Ga0102874_1229716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300007547|Ga0102875_1103467 | Not Available | 909 | Open in IMG/M |
3300007548|Ga0102877_1033779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1493 | Open in IMG/M |
3300007549|Ga0102879_1063754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300007549|Ga0102879_1115195 | Not Available | 831 | Open in IMG/M |
3300007549|Ga0102879_1122023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 804 | Open in IMG/M |
3300007593|Ga0102918_1004272 | All Organisms → Viruses → Predicted Viral | 3403 | Open in IMG/M |
3300007627|Ga0102869_1151309 | Not Available | 626 | Open in IMG/M |
3300007629|Ga0102895_1034591 | Not Available | 1288 | Open in IMG/M |
3300007651|Ga0102900_1051755 | Not Available | 867 | Open in IMG/M |
3300007667|Ga0102910_1090660 | Not Available | 707 | Open in IMG/M |
3300007706|Ga0102899_1087968 | Not Available | 753 | Open in IMG/M |
3300007716|Ga0102867_1142268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300007974|Ga0105747_1115297 | Not Available | 848 | Open in IMG/M |
3300008021|Ga0102922_1111097 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300008113|Ga0114346_1044182 | All Organisms → Viruses → Predicted Viral | 3838 | Open in IMG/M |
3300008113|Ga0114346_1197704 | Not Available | 806 | Open in IMG/M |
3300008267|Ga0114364_1076375 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300008964|Ga0102889_1023415 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
3300009024|Ga0102811_1061148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
3300009057|Ga0102892_1041021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300009059|Ga0102830_1041521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1407 | Open in IMG/M |
3300009059|Ga0102830_1105628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300009183|Ga0114974_10132822 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
3300010312|Ga0102883_1161157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300010354|Ga0129333_11467004 | Not Available | 560 | Open in IMG/M |
3300010885|Ga0133913_12426975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1281 | Open in IMG/M |
3300011268|Ga0151620_1002030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7701 | Open in IMG/M |
3300011268|Ga0151620_1038734 | Not Available | 1600 | Open in IMG/M |
3300012352|Ga0157138_1008820 | Not Available | 1670 | Open in IMG/M |
3300012667|Ga0157208_10046051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300017766|Ga0181343_1101307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300019784|Ga0181359_1015144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2848 | Open in IMG/M |
3300020141|Ga0211732_1133039 | Not Available | 6928 | Open in IMG/M |
3300020141|Ga0211732_1597974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6817 | Open in IMG/M |
3300020160|Ga0211733_10665474 | Not Available | 2146 | Open in IMG/M |
3300020172|Ga0211729_11018497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300020205|Ga0211731_11403180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300020498|Ga0208050_1029260 | Not Available | 549 | Open in IMG/M |
3300020527|Ga0208232_1034613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300020534|Ga0208596_1005844 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
3300020535|Ga0208228_1031558 | Not Available | 855 | Open in IMG/M |
3300020561|Ga0207934_1004226 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
3300020563|Ga0208082_1007472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2670 | Open in IMG/M |
3300020563|Ga0208082_1016313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1596 | Open in IMG/M |
3300021961|Ga0222714_10015231 | Not Available | 6258 | Open in IMG/M |
3300021961|Ga0222714_10223323 | All Organisms → Viruses | 1073 | Open in IMG/M |
3300021962|Ga0222713_10018428 | All Organisms → Viruses | 5941 | Open in IMG/M |
3300021962|Ga0222713_10379443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300021962|Ga0222713_10626970 | All Organisms → Viruses | 623 | Open in IMG/M |
3300021963|Ga0222712_10222571 | Not Available | 1222 | Open in IMG/M |
3300021963|Ga0222712_10595613 | All Organisms → Viruses | 639 | Open in IMG/M |
3300024289|Ga0255147_1076777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300024343|Ga0244777_10001475 | Not Available | 16911 | Open in IMG/M |
3300024343|Ga0244777_10077026 | All Organisms → Viruses → Predicted Viral | 2144 | Open in IMG/M |
3300024343|Ga0244777_10374972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300024346|Ga0244775_10010552 | All Organisms → Viruses | 8796 | Open in IMG/M |
3300024346|Ga0244775_10379392 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
3300024346|Ga0244775_10720278 | All Organisms → Viruses | 803 | Open in IMG/M |
3300024346|Ga0244775_10864879 | All Organisms → Viruses | 720 | Open in IMG/M |
3300027124|Ga0255116_1039075 | Not Available | 633 | Open in IMG/M |
3300027144|Ga0255102_1051413 | Not Available | 663 | Open in IMG/M |
3300027186|Ga0208797_1025813 | Not Available | 776 | Open in IMG/M |
3300027193|Ga0208800_1011603 | All Organisms → Viruses | 1129 | Open in IMG/M |
3300027232|Ga0208803_1018281 | Not Available | 1450 | Open in IMG/M |
3300027234|Ga0208170_1100432 | All Organisms → Viruses | 514 | Open in IMG/M |
3300027237|Ga0208930_1024937 | Not Available | 849 | Open in IMG/M |
3300027418|Ga0208022_1083096 | All Organisms → Viruses | 675 | Open in IMG/M |
3300027493|Ga0255103_1061328 | Not Available | 640 | Open in IMG/M |
3300027782|Ga0209500_10164237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300027836|Ga0209230_10086167 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
3300027836|Ga0209230_10441093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300027892|Ga0209550_10627939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300028025|Ga0247723_1000470 | Not Available | 27817 | Open in IMG/M |
3300028025|Ga0247723_1002404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 10012 | Open in IMG/M |
3300028073|Ga0255180_1070147 | All Organisms → Viruses | 653 | Open in IMG/M |
3300032092|Ga0315905_10105099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2845 | Open in IMG/M |
3300032092|Ga0315905_11299507 | Not Available | 586 | Open in IMG/M |
3300034013|Ga0334991_0039175 | All Organisms → Viruses → Predicted Viral | 2568 | Open in IMG/M |
3300034060|Ga0334983_0007402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7429 | Open in IMG/M |
3300034060|Ga0334983_0354391 | All Organisms → Viruses | 860 | Open in IMG/M |
3300034068|Ga0334990_0076715 | All Organisms → Viruses → Predicted Viral | 1799 | Open in IMG/M |
3300034102|Ga0335029_0753319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300034110|Ga0335055_0156844 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300034110|Ga0335055_0204298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300034117|Ga0335033_0352022 | All Organisms → Viruses | 739 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 28.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 12.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.81% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.81% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.92% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.92% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.92% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.92% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.96% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027124 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027232 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027237 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027493 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199950880 | 2199352004 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKTIKEEKNAKTSDGAPDAIKSK |
2199969158 | 2199352004 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK |
B570J13884_10005221 | 3300001266 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKTIKEEKNAKTSDGAPDAIKSK* |
B570J13884_1057393 | 3300001266 | Freshwater | KRITVMTLNLKIEILKVFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK* |
B570J14230_100976191 | 3300001282 | Freshwater | KRITVMTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDGAPDATKSK* |
B570J29032_1087505312 | 3300002408 | Freshwater | IEILKVFSFDLNFSSDNKNKKEEKDAKTSDGAPDATKSK* |
B570J29032_1095484931 | 3300002408 | Freshwater | IEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK* |
B570J40625_1000135483 | 3300002835 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK* |
JGI25914J50564_100343212 | 3300003429 | Freshwater Lake | MTINLKIELLKVFTIDFSFSSDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0063233_100235674 | 3300003986 | Freshwater Lake | INLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0066177_105788593 | 3300004096 | Freshwater Lake | MMLKIKIEILKVFTLELDFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0070374_100365325 | 3300005517 | Freshwater Lake | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0070374_104217401 | 3300005517 | Freshwater Lake | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSD |
Ga0049081_100284582 | 3300005581 | Freshwater Lentic | MTLNIKIEILKVFTFDLNFSSDNKKLKKEEENVKTSDPAPDATKSK* |
Ga0049081_100692752 | 3300005581 | Freshwater Lentic | MTLNLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDPAPDTTKSK* |
Ga0078894_106105044 | 3300005662 | Freshwater Lake | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0075473_103731701 | 3300006875 | Aqueous | MTLNLKIEILKVFTVDLNFSSDNKNKKEEKDAKTS |
Ga0102873_10551211 | 3300007545 | Estuarine | LNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0102874_12297162 | 3300007546 | Estuarine | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0102875_11034674 | 3300007547 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK* |
Ga0102877_10337794 | 3300007548 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATESK* |
Ga0102879_10637543 | 3300007549 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102879_11151954 | 3300007549 | Estuarine | MTLNLKIEILKVFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102879_11220231 | 3300007549 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKKIKEEKDAKTSDDAPGTTKSK* |
Ga0102918_10042721 | 3300007593 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATETK* |
Ga0102869_11513093 | 3300007627 | Estuarine | LKVFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102895_10345913 | 3300007629 | Estuarine | IEILKVFTFDLNFSSDNKKIKEEKDVKTSDDAPATTKSK* |
Ga0102900_10517551 | 3300007651 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAP |
Ga0102910_10906601 | 3300007667 | Estuarine | LLKVFTIDFNFSSDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102899_10879681 | 3300007706 | Estuarine | VNINLKIELLKVFTIDFSFSSDNKNKKEEKNAKTS |
Ga0102867_11422681 | 3300007716 | Estuarine | MTLNLKIEILKVFSFDLNFASDNKNKKEEKNAKTS |
Ga0105747_11152971 | 3300007974 | Estuary Water | IIAMTINLKIELLKVFTIDFNFSSDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102922_11110973 | 3300008021 | Estuarine | KVFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0114346_10441821 | 3300008113 | Freshwater, Plankton | VTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDASGTTKSK* |
Ga0114346_11977041 | 3300008113 | Freshwater, Plankton | VTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDAPATTKSK* |
Ga0114364_10763753 | 3300008267 | Freshwater, Plankton | MLKIKIEILKVFTLELDFSSNKTIKEEKNAKTSDSAPDATKSK* |
Ga0102889_10234154 | 3300008964 | Estuarine | MTINLKIELLKVFTIDFSFSSDNKNKKEEKDAKTSDDAPGATKSK* |
Ga0102811_10611481 | 3300009024 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPDATKSK* |
Ga0102892_10410212 | 3300009057 | Estuarine | MTLNLKIEILKVFSFDLNFSSDNKKIKEEKDVKTIDPAPDTTKSK* |
Ga0102830_10415211 | 3300009059 | Estuarine | LKIEILKVFTFDLNLSSDNKNKKEEKDAKTSDVAPGATKSK* |
Ga0102830_11056284 | 3300009059 | Estuarine | MTINLKIEILKVFSFDLNFSSDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0114974_101328224 | 3300009183 | Freshwater Lake | VFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK* |
Ga0102883_11611571 | 3300010312 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKKIKEEKDVKTI |
Ga0129333_114670042 | 3300010354 | Freshwater To Marine Saline Gradient | IAMTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSNDAPDATKSK* |
Ga0133913_124269751 | 3300010885 | Freshwater Lake | IEILKVFSFDLNFASDNKNKKEEKNAKTSDDAPDTTKSK* |
Ga0151620_100203010 | 3300011268 | Freshwater | MTINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTGDDAPDATKSK* |
Ga0151620_10387344 | 3300011268 | Freshwater | MTLNLKIEILKVFTFDLNFSSENKNKKEEKDAKTSSGAPDATKSK* |
Ga0157138_10088203 | 3300012352 | Freshwater | MLKIKIEILKVFTLELDFSSNKTIKEEKHAKTSDDAPATTKSK* |
Ga0157208_100460511 | 3300012667 | Freshwater | VNINLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDDAPA |
Ga0181343_11013072 | 3300017766 | Freshwater Lake | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPATTKSK |
Ga0181359_10151444 | 3300019784 | Freshwater Lake | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0211732_11330392 | 3300020141 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKTIKEEKNAKTSDGAPDATKSK |
Ga0211732_15979742 | 3300020141 | Freshwater | MTLNLKIEILKVFSFDLNFASDNKTKREEKNAKTSDDAPDATKSK |
Ga0211733_106654742 | 3300020160 | Freshwater | MMLKIKIEILKVFTLELDFSSNKTIKEEKNAKTSDDAPAIAKSK |
Ga0211729_110184972 | 3300020172 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKTIKEEKNAKTSDDAPAIAKSK |
Ga0211731_114031803 | 3300020205 | Freshwater | MMLKIKIEILKVFTLELDFSSNKTIKEEKNAKTSDDAPATTKSK |
Ga0208050_10292602 | 3300020498 | Freshwater | ILKVFTFDLNFSSDNKPKKEEKDVKTSDDAPATTKSK |
Ga0208232_10346133 | 3300020527 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDGAPDATKSK |
Ga0208596_10058443 | 3300020534 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKNAKTSDDAPDATKSK |
Ga0208228_10315583 | 3300020535 | Freshwater | KVFTFDLNFSSDNKPKKEEKDVKTSDDAPATTKSK |
Ga0207934_10042261 | 3300020561 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTT |
Ga0208082_10074721 | 3300020563 | Freshwater | KVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK |
Ga0208082_10163131 | 3300020563 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKTIKEEKNAKTSDGAPDAIKS |
Ga0222714_100152313 | 3300021961 | Estuarine Water | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGTTKSK |
Ga0222714_102233232 | 3300021961 | Estuarine Water | MTINLKIELLKVFTIDFNFSSDNKNKKEEKNAKTSDDAPDATKSK |
Ga0222713_100184285 | 3300021962 | Estuarine Water | MTINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTGDDAPDATKSK |
Ga0222713_103794433 | 3300021962 | Estuarine Water | MTLNLKIEILKVFTVDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0222713_106269702 | 3300021962 | Estuarine Water | MTLNLKIEILKVFSLELNFSSDNKNKKEEKDAKKSDDAPGATKPK |
Ga0222712_102225711 | 3300021963 | Estuarine Water | IAMTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0222712_105956133 | 3300021963 | Estuarine Water | MMLKIKIEILKVFSLDLEFSSAKTKKEEKDAKTSDDAPDATKSK |
Ga0255147_10767772 | 3300024289 | Freshwater | MTLNLKIEILKVLTFDLNFSSDKNIKEEKNVKTSDDAPAAKSK |
Ga0244777_100014754 | 3300024343 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATESK |
Ga0244777_100770261 | 3300024343 | Estuarine | MTINLKIELLKVFTIDFSFSSDNKNKKEEKNAKTSDDAPDATKSK |
Ga0244777_103749722 | 3300024343 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0244775_100105523 | 3300024346 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDPAPDTTKSK |
Ga0244775_103793921 | 3300024346 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTSDDAPDATKSK |
Ga0244775_107202783 | 3300024346 | Estuarine | LKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0244775_108648791 | 3300024346 | Estuarine | MTLNLKIEILKVFSFDLNFASDNKNKKEEKNAKTSDDAPDATKSK |
Ga0255116_10390752 | 3300027124 | Freshwater | IITMTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATKSK |
Ga0255102_10514132 | 3300027144 | Freshwater | MTLNIKIEILKVFTFDLNFSSDNKKLKKEEENVKTSDPAPDATKSK |
Ga0208797_10258131 | 3300027186 | Estuarine | KRIIVMTLNLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDPAPDTTKSK |
Ga0208800_10116034 | 3300027193 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTSDDA |
Ga0208803_10182814 | 3300027232 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGA |
Ga0208170_11004321 | 3300027234 | Estuarine | MTINLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATES |
Ga0208930_10249373 | 3300027237 | Estuarine | IEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATESK |
Ga0208022_10830963 | 3300027418 | Estuarine | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGATESK |
Ga0255103_10613281 | 3300027493 | Freshwater | LKVFTFDLNFSSDNKKLKKEEENVKTSDPAPDATKSK |
Ga0209500_101642373 | 3300027782 | Freshwater Lake | KVFSFDLNFASDNKNKKEEKNAKTSDDAPDTTKSK |
Ga0209230_100861674 | 3300027836 | Freshwater And Sediment | MMLKIKIEILKVFTLELDFSSNKTIKEEKHAKTSDDAPATTKSK |
Ga0209230_104410932 | 3300027836 | Freshwater And Sediment | MTLNLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDPAPDATKSK |
Ga0209550_106279392 | 3300027892 | Freshwater Lake | VTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDASGTTKSK |
Ga0247723_100047036 | 3300028025 | Deep Subsurface Sediment | RRITVTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDASGTTKSK |
Ga0247723_10024045 | 3300028025 | Deep Subsurface Sediment | VTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDAPATTKSK |
Ga0255180_10701472 | 3300028073 | Freshwater | MTLNLKIEILKVFSFELDFSSTKKTKEEKDVKTSDNAPATKSK |
Ga0315905_101050993 | 3300032092 | Freshwater | MTINLKIELLKVFTIDFSFSSDNKNNKEEKNAKTSDDAPDATKSK |
Ga0315905_112995072 | 3300032092 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSNDAPDATKSK |
Ga0334991_0039175_600_737 | 3300034013 | Freshwater | VNINLKIEILKVFTFDLNFSSDNKNKKEEKNAKTSDDAPDATKSK |
Ga0334983_0007402_373_504 | 3300034060 | Freshwater | MLKIKIEILKVFTLELDFSSNKTIKEEKHAKTSDDAPATTKSK |
Ga0334983_0354391_413_550 | 3300034060 | Freshwater | MTINLKIEILKVFTFDLNFSSDNKKIKEEKDVKTSDDAPATTKSK |
Ga0334990_0076715_1671_1799 | 3300034068 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTSDDAPGTTK |
Ga0335029_0753319_52_189 | 3300034102 | Freshwater | MTLNLKIEILKVFSFDLNFASDNKNKKEEKDAKTSDDAPGATKSK |
Ga0335055_0156844_918_1022 | 3300034110 | Freshwater | MTLNLKIEILKVFSFDLNFSSDNKNKKEEKDAKTS |
Ga0335055_0204298_630_767 | 3300034110 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKPKKEEKDVKTSDDAPATTKSK |
Ga0335033_0352022_614_739 | 3300034117 | Freshwater | MTLNLKIEILKVFTFDLNFSSDNKNKKEEKDAKTSDDAPGTT |
⦗Top⦘ |