Basic Information | |
---|---|
Family ID | F097025 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | FKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.98 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 94.23 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.16 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.231 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (43.269 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.654 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (74.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 4.81 |
PF04185 | Phosphoesterase | 2.88 |
PF13088 | BNR_2 | 1.92 |
PF13545 | HTH_Crp_2 | 0.96 |
PF13671 | AAA_33 | 0.96 |
PF08238 | Sel1 | 0.96 |
PF01258 | zf-dskA_traR | 0.96 |
PF13620 | CarboxypepD_reg | 0.96 |
PF00313 | CSD | 0.96 |
PF01609 | DDE_Tnp_1 | 0.96 |
PF01384 | PHO4 | 0.96 |
PF04191 | PEMT | 0.96 |
PF13518 | HTH_28 | 0.96 |
PF14417 | MEDS | 0.96 |
PF11345 | DUF3147 | 0.96 |
PF00069 | Pkinase | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF12840 | HTH_20 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.85 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 2.88 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.96 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.96 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.96 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.96 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.96 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.23 % |
Unclassified | root | N/A | 5.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002558|JGI25385J37094_10158605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300002558|JGI25385J37094_10172721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300002560|JGI25383J37093_10071721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
3300002562|JGI25382J37095_10146783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300002908|JGI25382J43887_10212031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
3300005175|Ga0066673_10069040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1831 | Open in IMG/M |
3300005177|Ga0066690_10306338 | Not Available | 1073 | Open in IMG/M |
3300005177|Ga0066690_10552080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300005177|Ga0066690_10916853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300005178|Ga0066688_10390184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300005180|Ga0066685_10158136 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300005180|Ga0066685_10174363 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300005186|Ga0066676_10721727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300005447|Ga0066689_10417405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300005450|Ga0066682_10364529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
3300005454|Ga0066687_10382861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300005455|Ga0070663_100991053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300005540|Ga0066697_10086308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1816 | Open in IMG/M |
3300005552|Ga0066701_10343435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
3300005552|Ga0066701_10393430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300005553|Ga0066695_10168041 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300005555|Ga0066692_10054148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2241 | Open in IMG/M |
3300005555|Ga0066692_10502320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300005556|Ga0066707_10658224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300005557|Ga0066704_10551970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300005561|Ga0066699_10564524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300005568|Ga0066703_10172543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
3300005574|Ga0066694_10156628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
3300005575|Ga0066702_10630239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300005576|Ga0066708_10102809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1700 | Open in IMG/M |
3300005617|Ga0068859_100607729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
3300006032|Ga0066696_10433268 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300006032|Ga0066696_10987560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300006032|Ga0066696_11092781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300006794|Ga0066658_10062178 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300006794|Ga0066658_10906733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300006796|Ga0066665_10619928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
3300006796|Ga0066665_10625158 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300006797|Ga0066659_10842751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300006800|Ga0066660_10441089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
3300006854|Ga0075425_101482223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300007076|Ga0075435_100231893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
3300009012|Ga0066710_103538997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300009012|Ga0066710_103765977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300009012|Ga0066710_103895340 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema bryantii | 559 | Open in IMG/M |
3300009038|Ga0099829_10916884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300009137|Ga0066709_100716811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
3300009137|Ga0066709_104578676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300009177|Ga0105248_13304155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300009545|Ga0105237_11206604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300010360|Ga0126372_10397969 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300010360|Ga0126372_11315903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300010366|Ga0126379_11668625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300010376|Ga0126381_104828748 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010398|Ga0126383_13643896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300012096|Ga0137389_11611652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300012199|Ga0137383_10278370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
3300012207|Ga0137381_10292203 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300012211|Ga0137377_11480952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300012211|Ga0137377_11787298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012349|Ga0137387_10430190 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300012351|Ga0137386_10120890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
3300012351|Ga0137386_10423333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
3300012357|Ga0137384_11084767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300012359|Ga0137385_11392427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300012361|Ga0137360_11131011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300012929|Ga0137404_11401166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300012951|Ga0164300_11042260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300012957|Ga0164303_10272745 | Not Available | 982 | Open in IMG/M |
3300012972|Ga0134077_10089776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
3300014968|Ga0157379_10478474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
3300015359|Ga0134085_10028925 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
3300015374|Ga0132255_101853454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
3300016319|Ga0182033_11012641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300017961|Ga0187778_10056531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2400 | Open in IMG/M |
3300018468|Ga0066662_10245884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1458 | Open in IMG/M |
3300018468|Ga0066662_11905530 | Not Available | 622 | Open in IMG/M |
3300018482|Ga0066669_12462332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300021362|Ga0213882_10491927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300021560|Ga0126371_10635399 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300025922|Ga0207646_10694880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
3300026298|Ga0209236_1040073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2421 | Open in IMG/M |
3300026315|Ga0209686_1075407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
3300026323|Ga0209472_1053031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
3300026329|Ga0209375_1202994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300026335|Ga0209804_1088561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1439 | Open in IMG/M |
3300026342|Ga0209057_1089597 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300026523|Ga0209808_1101254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
3300026528|Ga0209378_1201660 | Not Available | 658 | Open in IMG/M |
3300026532|Ga0209160_1309033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300026538|Ga0209056_10196753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1480 | Open in IMG/M |
3300026540|Ga0209376_1369521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300026547|Ga0209156_10386755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300026552|Ga0209577_10617117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300027727|Ga0209328_10221149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300027748|Ga0209689_1361159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300031718|Ga0307474_10884217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300031912|Ga0306921_10367310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1682 | Open in IMG/M |
3300031941|Ga0310912_10971676 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031946|Ga0310910_10472146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
3300032001|Ga0306922_11292788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300032001|Ga0306922_12386051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 43.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.46% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25385J37094_101586051 | 3300002558 | Grasslands Soil | ILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR* |
JGI25385J37094_101727211 | 3300002558 | Grasslands Soil | TWFKILNRKYSQKDGREELFERERHSEPVPGWHSCALACTELEENA* |
JGI25383J37093_100717212 | 3300002560 | Grasslands Soil | KIRNKGYSQMVGREELFERDRHSEPVLGWHSCELACAGVEG* |
JGI25382J37095_101467832 | 3300002562 | Grasslands Soil | TWFKIRNREYSQMQGREKLFERERHSEPVPGWHSCDLACASLEV* |
JGI25382J43887_102120313 | 3300002908 | Grasslands Soil | STWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES* |
Ga0066673_100690404 | 3300005175 | Soil | ILNREYSQKDGREELFERERHSEPVAGWHSCALACAGVEGN* |
Ga0066690_103063382 | 3300005177 | Soil | STWFKILNREYSQMQGREELFERERHGEPVPGWHSCELACAELEQLDV* |
Ga0066690_105520801 | 3300005177 | Soil | STWFKILNRGYSQMQGREELFERERRQEPVPGWHSCAVACEELNPNIRT* |
Ga0066690_109168531 | 3300005177 | Soil | ILNREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN* |
Ga0066688_103901841 | 3300005178 | Soil | VTEREQSTWYKILNREYSQKDGREELFERERHAEPVPGWHLCDLACVDL* |
Ga0066685_101581361 | 3300005180 | Soil | EQSTWFKILNREYSQKEGREELFERERHNEPVAGWHVCDLACAGVEGN* |
Ga0066685_101743631 | 3300005180 | Soil | KILNREYSQKDGREELFERERHQEPVPGWHLCDLACVDL* |
Ga0066676_107217272 | 3300005186 | Soil | GTRQSTWFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR* |
Ga0066689_104174051 | 3300005447 | Soil | ENSTWFKIRNRAYSQMQRREELFQRERHREPAPGWHSCDLACASLEAVN* |
Ga0066682_103645291 | 3300005450 | Soil | WFKILNREYSQKDGREELFERERHQEPVAGWHVCALACAELEHVNR* |
Ga0066687_103828613 | 3300005454 | Soil | QSTWFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR* |
Ga0070663_1009910532 | 3300005455 | Corn Rhizosphere | KNRNYSQMQGREELFERERHQEPVAGWHSCELACAEAEQWINGL* |
Ga0070697_1004964011 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TTWFKIKNRNYSQMEGREKLFERERHQEPASGWHCCELACAELEEDYAST* |
Ga0066697_100863081 | 3300005540 | Soil | ILNREYSQKDGREELFERERRQEPVPGWHLCDLACGNAEQ* |
Ga0066701_103434351 | 3300005552 | Soil | STWFKILNREYSQKDGREELFERERHQEPVPGWHSCAVACEELNPNVRT* |
Ga0066701_103934302 | 3300005552 | Soil | FKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS* |
Ga0066695_101680412 | 3300005553 | Soil | KILNREYSQKDGREELFERERHSEPVAGWHVCVLACAELERLRR* |
Ga0066692_100541481 | 3300005555 | Soil | NREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN* |
Ga0066692_105023201 | 3300005555 | Soil | STWYKILNREYSQKDGREELFERERHSEPVPGWHSCAVACEELNPNVRT* |
Ga0066707_106582241 | 3300005556 | Soil | KILNREYSQKDGREELFERERHSEPVAGWHVCALVCEALNG* |
Ga0066704_105519701 | 3300005557 | Soil | RNRGYSQMVGRDQLFERDQHKEPVPGWHTCDLACEDAA* |
Ga0066699_105645242 | 3300005561 | Soil | WYKIRNPGYSQMVGRNEMFERERHKEPVPGWHTCELACAEAT* |
Ga0066703_101725432 | 3300005568 | Soil | YSQKDGREELFERERHQEPVAGWHSCDFLEAADN* |
Ga0066694_101566281 | 3300005574 | Soil | LNREYSQKNGREKLFERERHSEPVAGWHVCVLACAELEQVNR* |
Ga0066702_106302392 | 3300005575 | Soil | LNREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN* |
Ga0066708_101028091 | 3300005576 | Soil | RGYSQMVWREELFDRERHQEPVAGWHVCVLACAELEML* |
Ga0068859_1006077294 | 3300005617 | Switchgrass Rhizosphere | ERERTTWFKIRKPKYLQMGGREKLRERHSEPVPGWHSCDLACSEL* |
Ga0066696_104332681 | 3300006032 | Soil | WFKILNREYSQKDGREELFERERHNEPVAGWHVCDLACAGVEGN* |
Ga0066696_109875603 | 3300006032 | Soil | TWFKILNREYSQKDGREELFERERHQEPVAGWHSCELACAGVGG* |
Ga0066696_110927811 | 3300006032 | Soil | EREHSTWYKILNRGYSQKDGREELFERERHSEPVAGRHVCELACADL* |
Ga0066658_100621784 | 3300006794 | Soil | WFKILNRGYSQKQGREELFERERHKEPVPGWHRCAIVCADAGVNV* |
Ga0066658_109067331 | 3300006794 | Soil | LNRGYSQKDGREELFERERHSEPVAGWHVCVLACEATAE* |
Ga0066665_106199281 | 3300006796 | Soil | TTWYKILNPGYSQRLGREELFERDRHKQPVPGWHRCALACAESEEMNA* |
Ga0066665_106251581 | 3300006796 | Soil | WYKILNREYSQKDGREELFERERHSEPVAGWHSCSLACAGVEGY* |
Ga0066659_108427512 | 3300006797 | Soil | KILNREYSQKDGREDLFERERHSEPVPGWHSCAIACAELEEVSG* |
Ga0066659_116137192 | 3300006797 | Soil | FKILNRKYSQKDGREELFERERHSEPVPGWHSCAVACEELNPEELNPNVRT* |
Ga0066660_104410891 | 3300006800 | Soil | WYKILNRGYSQKDGREELFERERHSEPVAGWHVCDLVCVDL* |
Ga0075425_1014822231 | 3300006854 | Populus Rhizosphere | WFKILNREYSQKDGREDLFERERHSEPVPGWHDCVLACEALSER* |
Ga0075435_1002318935 | 3300007076 | Populus Rhizosphere | TWFKIKNRNYSQMAGREKLFERDRHREPVPGWHCCELACAEVEYAES* |
Ga0066710_1035389972 | 3300009012 | Grasslands Soil | EREHSTWFKILNREYSQKDGREDLFERERHSEPVPGWHLCDLACAELEEGAA |
Ga0066710_1037659771 | 3300009012 | Grasslands Soil | FKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS |
Ga0066710_1038953401 | 3300009012 | Grasslands Soil | KILNREYSQKDGREELFERERHSEPVAGWHVCVLACAELERLRR |
Ga0099829_109168841 | 3300009038 | Vadose Zone Soil | GRTTWFKIKNRAYSQMEGREKLFERERHREPVPGWHSCELACADV* |
Ga0066709_1007168111 | 3300009137 | Grasslands Soil | YSQKDGREELFDRERHQEPVAGWHSCTIACASLEAADN* |
Ga0066709_1045786761 | 3300009137 | Grasslands Soil | RSQTTSGAKEGREELFERERHSEPVPGWHSCVLACAELGVNR* |
Ga0105248_133041551 | 3300009177 | Switchgrass Rhizosphere | FKIKNRNYSQMQGREELFERERHGEPVAGWHSCELACAEVENELSD* |
Ga0105237_112066041 | 3300009545 | Corn Rhizosphere | IKNRNYSQMQGREELFERERHREPVAGWHSCELACAEVENELSD* |
Ga0126372_103979691 | 3300010360 | Tropical Forest Soil | IRNRSYSQMAGREELFERERHSEPMPGWHSSDIACALLEVLS* |
Ga0126372_113159033 | 3300010360 | Tropical Forest Soil | WIKILNREYSQKQGREELFERERHKEPVAGWHSCVLTSAELEKAS* |
Ga0126379_116686251 | 3300010366 | Tropical Forest Soil | ILNPNYSQRVGREERFERDRHQEPVAGWRSCAVACAELEEAVEPNLSKS* |
Ga0126381_1048287481 | 3300010376 | Tropical Forest Soil | NREYSQKQGREELFERERHREPVAGWHSCVVACEELAK* |
Ga0126383_136438961 | 3300010398 | Tropical Forest Soil | YSQIIGREELFERERGSDPVPGWPSCAIASAESK* |
Ga0137389_116116521 | 3300012096 | Vadose Zone Soil | STWFKILNRRYSQIQGREELFDRERHNEPVPGWHSCDLACASLEAVN* |
Ga0137383_102783702 | 3300012199 | Vadose Zone Soil | WFKILNRKYSQMQGREKLFERERHQEPVAGWHACALACASLEAADN* |
Ga0137381_102922031 | 3300012207 | Vadose Zone Soil | KILNREYSQKDGREELFERERHSEPVPGWDSCALACARAEGG* |
Ga0137377_114809522 | 3300012211 | Vadose Zone Soil | FKILNREYSQKDGREDLFERERHSEPVPGWRSCELACAELEERST* |
Ga0137377_117872981 | 3300012211 | Vadose Zone Soil | WFKILNREYSQKDGREELFERERHQEPVPGWHSCVLACTRAEG* |
Ga0137387_104301901 | 3300012349 | Vadose Zone Soil | NREYSQKDGREELFEREQHSEPVAGWHVCAISCAELEEAS* |
Ga0137386_101208901 | 3300012351 | Vadose Zone Soil | KILNREYSQKDGREELFERERHSEPVPGWHACVLACEALSE* |
Ga0137386_104233333 | 3300012351 | Vadose Zone Soil | WFKILNRKYSQMQGREELFDRERHQEPVAGWHSCDLACVRAEAG* |
Ga0137384_110847671 | 3300012357 | Vadose Zone Soil | REQSTWFKIRNRNYSQMVGREEMFERDRHSEPVAGWHVCDLACAGVEG* |
Ga0137385_113924272 | 3300012359 | Vadose Zone Soil | WFKILNRKYSQMQGREELFNREEPVPGWHSCDLACAESES* |
Ga0137360_111310111 | 3300012361 | Vadose Zone Soil | WFKIKNRAYSQMEGREKLFERERHREPVPGWHSCELACAEVEQ* |
Ga0137404_114011661 | 3300012929 | Vadose Zone Soil | HPTSQSESSTGFKILNREYSQKVGREELFERERHSEPVAGWHACALACAELEHVNR* |
Ga0164300_110422602 | 3300012951 | Soil | RTTWFKIKNRNYSHMQGREELFERERHKEPVAGWHACDLACAVVEQ* |
Ga0164303_102727451 | 3300012957 | Soil | NRGYSQMQRREELFERERHRERVAGWHSCELDCAEVENA* |
Ga0134077_100897763 | 3300012972 | Grasslands Soil | REQSTWFKILNREYSQKDGREELFERERHQEPVAGWHVCALACAELEHVNR* |
Ga0157379_104784741 | 3300014968 | Switchgrass Rhizosphere | RTTWFKIKNRNYSQMQGREELFNRERHSEPTPGWHTCDLACTEVAS* |
Ga0134085_100289251 | 3300015359 | Grasslands Soil | KILNREYSQKDGREELFERERHNEPVAGWHVCAIACAELEEAS* |
Ga0132255_1018534543 | 3300015374 | Arabidopsis Rhizosphere | WFKIKNPKYSQMEGREQLFDRERHQEPAPGWHSCELASAEAEQ* |
Ga0182033_110126411 | 3300016319 | Soil | NRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEAAS |
Ga0187778_100565317 | 3300017961 | Tropical Peatland | SNREETTWFKILNRGYSQKQGREELFERERQKEPVPGWHSCAIACAELEAS |
Ga0066662_102458841 | 3300018468 | Grasslands Soil | KKSTWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES |
Ga0066662_119055301 | 3300018468 | Grasslands Soil | WFKVLNREYSQKQGREELFERERHKEPVPGWHRCVIACAEAGVGV |
Ga0066669_124623322 | 3300018482 | Grasslands Soil | WFKILNRGYSQKDGREELFDRDRHQEPVAGWHSCTIACASLEAADN |
Ga0213882_104919271 | 3300021362 | Exposed Rock | FKIRNRSYSQWIGREQLFDRDRHQEPVAGWHNCTLAAAVVEG |
Ga0126371_106353991 | 3300021560 | Tropical Forest Soil | KILNPNYSQRVGREELFERDRHKEPVAGWHSCAVARAELEEAV |
Ga0207646_106948802 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FKILNREYSQKDGREELFERERHQEPVAGWHCCAIGCTELES |
Ga0209236_10400735 | 3300026298 | Grasslands Soil | FKILNREYSQKDGREELFKRERHQEPVAGWHSCDLACASLEGVASMPERR |
Ga0209686_10754073 | 3300026315 | Soil | WFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR |
Ga0209472_10530313 | 3300026323 | Soil | QSTWFKIRNKGYSQMVGREELLERDRHSEPVLGWHSCELACAGVEG |
Ga0209375_12029943 | 3300026329 | Soil | YKILNREYSQMQGREELFDRERHSEPVAGWHSCDLACVRAEAG |
Ga0209804_10885613 | 3300026335 | Soil | NRGYSQKDGREELFERERHQEPVAGWHSCELACAGVGG |
Ga0209057_10895971 | 3300026342 | Soil | NREYSQKDGREELFERERHNEPVAGWHVCDLACAGVEGN |
Ga0209808_11012541 | 3300026523 | Soil | IRNRGYSQMVWREELFDRERHQEPVAGWHVCVLACAELEML |
Ga0209378_12016601 | 3300026528 | Soil | STWFKILNRGYSQMQGREELFERERHSEPVAGWHSWELACAELEHINAETRKLLL |
Ga0209160_13090331 | 3300026532 | Soil | NCKAKNSTWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES |
Ga0209056_101967533 | 3300026538 | Soil | LNREYSQKDGREELFERERHQEPVAGWHSCVLACGNAEQ |
Ga0209376_13695212 | 3300026540 | Soil | WYKILNREYSQKDGREELFERERHQEPVPGWHLCDLACVDL |
Ga0209156_103867551 | 3300026547 | Soil | NREYSQKDGREELFERERHQEPVAGWHSCVLVCAGVEG |
Ga0209577_106171172 | 3300026552 | Soil | WYKILNRGYSQKDGREELFERERHSEPVAGWHVCDLVCVDL |
Ga0209328_102211491 | 3300027727 | Forest Soil | TWIKIKNRSYSQSVGLEKLFERERHREPVPGWHSCELACELEHA |
Ga0209689_13611591 | 3300027748 | Soil | TWFKILNREYSQKDGKEELFERERHQEPVPGWHSCVLACVGLEAATRTL |
Ga0307474_108842171 | 3300031718 | Hardwood Forest Soil | NRDYSQMQGREELFERDRHEEPVPGWHTCELACAEMERAYA |
Ga0306921_103673103 | 3300031912 | Soil | VARQFKIRNREYSQMAGREELFERERHQEPVAGWHACTVACAALEEAS |
Ga0310912_109716761 | 3300031941 | Soil | MTVKILNRGYSQKQGREELFERDRHKEPVPGWHCCTIACAESESTA |
Ga0310910_104721463 | 3300031946 | Soil | TWAKILNRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEAAS |
Ga0306922_112927881 | 3300032001 | Soil | MASYAARAGSSTWAKILNRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEA |
Ga0306922_123860511 | 3300032001 | Soil | NREYSQMVGREELFERKRHQEPVAGWHACILACVEAVALVREWPQ |
⦗Top⦘ |