NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097048

Metagenome / Metatranscriptome Family F097048

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097048
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MLVIGADHVAAATGADAILLLAIPVLWIIGVIVFVALKFHSR
Number of Associated Samples 80
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 18.27 %
% of genes from short scaffolds (< 2000 bps) 78.85 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.308 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.961 % of family members)
Environment Ontology (ENVO) Unclassified
(35.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.269 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.57%    β-sheet: 0.00%    Coil/Unstructured: 51.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF03741TerC 58.65
PF01425Amidase 16.35
PF01381HTH_3 7.69
PF13560HTH_31 2.88
PF11528DUF3224 1.92
PF13482RNase_H_2 1.92
PF09369MZB 0.96
PF06824Glyco_hydro_125 0.96
PF05163DinB 0.96
PF00583Acetyltransf_1 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 58.65
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 16.35
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG3538Meiotically up-regulated gene 157 (Mug157) protein (function unknown)Function unknown [S] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.31 %
UnclassifiedrootN/A7.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_2468490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1045Open in IMG/M
3300004643|Ga0062591_100948947Not Available812Open in IMG/M
3300005172|Ga0066683_10078988All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300005172|Ga0066683_10435795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium805Open in IMG/M
3300005172|Ga0066683_10717644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium590Open in IMG/M
3300005174|Ga0066680_10007742All Organisms → cellular organisms → Bacteria5338Open in IMG/M
3300005176|Ga0066679_10189105All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300005186|Ga0066676_10415987All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300005338|Ga0068868_101684666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300005339|Ga0070660_101054970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300005440|Ga0070705_101104177Not Available649Open in IMG/M
3300005445|Ga0070708_100031456All Organisms → cellular organisms → Bacteria4593Open in IMG/M
3300005445|Ga0070708_100409680All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300005446|Ga0066686_10278117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1134Open in IMG/M
3300005447|Ga0066689_10515381All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005450|Ga0066682_10881108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium535Open in IMG/M
3300005467|Ga0070706_100181369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1966Open in IMG/M
3300005467|Ga0070706_100861658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium837Open in IMG/M
3300005468|Ga0070707_100029250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5246Open in IMG/M
3300005471|Ga0070698_100974950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi794Open in IMG/M
3300005518|Ga0070699_100611482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium994Open in IMG/M
3300005536|Ga0070697_100184661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1768Open in IMG/M
3300005536|Ga0070697_100547242All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005553|Ga0066695_10382465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium877Open in IMG/M
3300005561|Ga0066699_10440683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium932Open in IMG/M
3300005568|Ga0066703_10023724All Organisms → cellular organisms → Bacteria3206Open in IMG/M
3300005574|Ga0066694_10389249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium657Open in IMG/M
3300005578|Ga0068854_101013406Not Available736Open in IMG/M
3300006791|Ga0066653_10343321All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300006791|Ga0066653_10563053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium577Open in IMG/M
3300006797|Ga0066659_11265249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi615Open in IMG/M
3300006854|Ga0075425_100762613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1110Open in IMG/M
3300006904|Ga0075424_101064443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi862Open in IMG/M
3300007258|Ga0099793_10264299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium832Open in IMG/M
3300007258|Ga0099793_10296959Not Available784Open in IMG/M
3300007258|Ga0099793_10376982Not Available695Open in IMG/M
3300009012|Ga0066710_100053179All Organisms → cellular organisms → Bacteria5034Open in IMG/M
3300009012|Ga0066710_101847279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi909Open in IMG/M
3300009012|Ga0066710_102158807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi815Open in IMG/M
3300009090|Ga0099827_10062591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2843Open in IMG/M
3300009090|Ga0099827_11233406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium650Open in IMG/M
3300009137|Ga0066709_100056444All Organisms → cellular organisms → Bacteria → Proteobacteria4486Open in IMG/M
3300009137|Ga0066709_100394458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1918Open in IMG/M
3300009137|Ga0066709_101729689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi884Open in IMG/M
3300009137|Ga0066709_102731882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium657Open in IMG/M
3300010333|Ga0134080_10448678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium604Open in IMG/M
3300010335|Ga0134063_10189815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium964Open in IMG/M
3300010335|Ga0134063_10243758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi854Open in IMG/M
3300010371|Ga0134125_11377347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium769Open in IMG/M
3300010373|Ga0134128_11370546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium779Open in IMG/M
3300011270|Ga0137391_11028016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium670Open in IMG/M
3300012198|Ga0137364_11116013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300012203|Ga0137399_10133653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1963Open in IMG/M
3300012206|Ga0137380_10178593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1931Open in IMG/M
3300012207|Ga0137381_10531082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1026Open in IMG/M
3300012211|Ga0137377_11064856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium739Open in IMG/M
3300012211|Ga0137377_11433463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300012360|Ga0137375_10924204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium691Open in IMG/M
3300012363|Ga0137390_10355829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1445Open in IMG/M
3300012685|Ga0137397_10040020All Organisms → cellular organisms → Bacteria3352Open in IMG/M
3300012685|Ga0137397_10611573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium811Open in IMG/M
3300012918|Ga0137396_10458233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium945Open in IMG/M
3300012922|Ga0137394_10317379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1331Open in IMG/M
3300012922|Ga0137394_10807075Not Available786Open in IMG/M
3300012922|Ga0137394_10823466Not Available777Open in IMG/M
3300012925|Ga0137419_10042300All Organisms → cellular organisms → Bacteria2883Open in IMG/M
3300012927|Ga0137416_10212912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1558Open in IMG/M
3300012944|Ga0137410_10046919All Organisms → cellular organisms → Bacteria3066Open in IMG/M
3300012977|Ga0134087_10232635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium838Open in IMG/M
3300015245|Ga0137409_10056758All Organisms → cellular organisms → Bacteria3698Open in IMG/M
3300015245|Ga0137409_10828028Not Available761Open in IMG/M
3300017657|Ga0134074_1159145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium792Open in IMG/M
3300017657|Ga0134074_1354726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium541Open in IMG/M
3300018027|Ga0184605_10001960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6825Open in IMG/M
3300018027|Ga0184605_10013490All Organisms → cellular organisms → Bacteria3178Open in IMG/M
3300018028|Ga0184608_10001555All Organisms → cellular organisms → Bacteria6736Open in IMG/M
3300018028|Ga0184608_10478405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300018054|Ga0184621_10324795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300018071|Ga0184618_10075433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1279Open in IMG/M
3300018431|Ga0066655_10450918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium849Open in IMG/M
3300018433|Ga0066667_10025209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3246Open in IMG/M
3300019255|Ga0184643_1074822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300019879|Ga0193723_1022943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1905Open in IMG/M
3300020006|Ga0193735_1182553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium516Open in IMG/M
3300020015|Ga0193734_1054413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium730Open in IMG/M
3300021080|Ga0210382_10009664All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300022756|Ga0222622_10245698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1210Open in IMG/M
3300023058|Ga0193714_1002773All Organisms → cellular organisms → Bacteria2884Open in IMG/M
3300025910|Ga0207684_10180858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1818Open in IMG/M
3300025910|Ga0207684_10735446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium837Open in IMG/M
3300026301|Ga0209238_1175277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium632Open in IMG/M
3300026310|Ga0209239_1245809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300026313|Ga0209761_1143287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1135Open in IMG/M
3300026332|Ga0209803_1017251All Organisms → cellular organisms → Bacteria3638Open in IMG/M
3300026523|Ga0209808_1030554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2595Open in IMG/M
3300026536|Ga0209058_1031349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3278Open in IMG/M
3300027882|Ga0209590_10392061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium896Open in IMG/M
3300028536|Ga0137415_10110625All Organisms → cellular organisms → Bacteria2595Open in IMG/M
3300028796|Ga0307287_10083634All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300028811|Ga0307292_10293608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300028814|Ga0307302_10332741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300028828|Ga0307312_10813184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300028881|Ga0307277_10001783All Organisms → cellular organisms → Bacteria8342Open in IMG/M
3300031720|Ga0307469_10148449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1751Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil11.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.77%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0779.000006202162886012Miscanthus RhizosphereMLVIGADHVAAAAGPDAIALLLVPLLWILGVIVFVAFKLHFR
Ga0062591_10094894723300004643SoilMLVIGTDHVAAAAGSDAILLLAIPVLWVVGVIVFVAFKFHSR*
Ga0066683_1007898833300005172SoilMLMIGADHVAAAAGADAILFLAIPVIWIIGVIVFVAFKLHSR*
Ga0066683_1043579513300005172SoilMLVMGADHVAAAAGGEAILILAMPVLWILGVIAFVALKLRSR*
Ga0066683_1071764413300005172SoilMLVMGADHVVAAAGDEAILILAMPVLWILGVIVSVALKLRSR*
Ga0066680_1000774253300005174SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVIVSVALKLRSR*
Ga0066679_1018910523300005176SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGAIVSVAVQLRSR*
Ga0066676_1041598713300005186SoilMLMIGADHVAAAAGADAILFLAIPVIWIIGVIVFVAFKFHSR*
Ga0068868_10168466613300005338Miscanthus RhizosphereMLVMGADHVAAAAGPDAIALLLVPLLWILGVIVFVAFKLHSR*
Ga0070660_10105497013300005339Corn RhizosphereMLVIGADHVAAAAGPDAIALLLVPLLWILGVIVFVAFKLHSR*
Ga0070705_10110417723300005440Corn, Switchgrass And Miscanthus RhizosphereMGADHVAAAAGPDAIALLLVPLLWILGVIVFVAFKLHSR*
Ga0070708_10003145633300005445Corn, Switchgrass And Miscanthus RhizosphereMPAIGADHVAAASGGDAILLLAIPVLWMIGVVVFVAFKFHSR*
Ga0070708_10040968023300005445Corn, Switchgrass And Miscanthus RhizosphereMLVIGADHVAAAAGVDAIVLLAIPVLWVVGVVVFVAFKLRAR*
Ga0066686_1027811733300005446SoilMLMMGADHVAAAAGGEAILILAIPVLWILGVIAFVALKLRSR*
Ga0066689_1051538123300005447SoilMMLVMAADHVAAAVGGDALFLLAIPVLWLIGVVLLIAFKFRSR*
Ga0066682_1088110813300005450SoilMLMIGADHVAAAAGADAILFLAIPVIWIIGVIVIVAFKFHSR*
Ga0070706_10018136933300005467Corn, Switchgrass And Miscanthus RhizosphereMAVIGADHVSAAAGGDALLLLAIPVLWIIGVVVLVAFKFRSR*
Ga0070706_10086165823300005467Corn, Switchgrass And Miscanthus RhizosphereMLVIGADHIAAASGGDAILLLAIPVLWMIGVIVFVAFKFHSR*
Ga0070707_10002925053300005468Corn, Switchgrass And Miscanthus RhizosphereMLVIGADHVAAAAGVDAIVLLAIPVLWVVGVIVFVAFKLRAR*
Ga0070698_10097495013300005471Corn, Switchgrass And Miscanthus RhizosphereIGADHVAAAAGVDAIVLLAIPVLWVVGVVVFVAFKLRAR*
Ga0070699_10061148213300005518Corn, Switchgrass And Miscanthus RhizosphereMLLIGADHVASAAGADAIVLLAIPVLWMVGVVLFVAFKFHRR*
Ga0070697_10018466133300005536Corn, Switchgrass And Miscanthus RhizosphereMPAIGADHIAAASGGDAILLLAIPVLWMIGVVVFVAFKFHSR*
Ga0070697_10054724233300005536Corn, Switchgrass And Miscanthus RhizosphereMLAMGADHIAAAAGGDAILILAMPVLWMLGVILFVVLKLRSHQR*
Ga0066695_1038246523300005553SoilMLVIGADHVAAATGADAILLLAIPVLWIIGVIVFVALKFHSR*
Ga0066699_1044068323300005561SoilMLVIGTDHVVAAAGDEAILILAMPVLWILGVIVSVALKLRSR*
Ga0066703_1002372443300005568SoilMLVIGADHVAASAGGDALLLLAIPVLWIIGVVILVAFKFRAR*
Ga0066694_1038924913300005574SoilMLVMGADHVAAAAGGEAILILAIPVLWILGVIVFVALKLRSR*
Ga0068854_10101340613300005578Corn RhizosphereIGADHVAAAAGGDAMALLLVPLLWMLGVIVFVAFKLHSR*
Ga0066653_1034332123300006791SoilMLVIGADHVAAATGADAILLLAIPVLWIIGVIVVVALKFHSR*
Ga0066653_1056305323300006791SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVIAFVALKLRSR*
Ga0066659_1126524923300006797SoilGADHVVAAAGDEAILILAMPVLWILGVIVSVALKLRSR*
Ga0075425_10076261333300006854Populus RhizosphereVLVIGADHVTTAGGADAAFLLAIPALWLVGVILVVVYKYRSR*
Ga0075424_10106444323300006904Populus RhizosphereHVPAAVGLDGIVVLAVPVLWVVGVIVFVAFKLRAR*
Ga0099793_1026429933300007258Vadose Zone SoilMGTDHVAAAAGADAVLLLAFPVLWIIGVIVFVAFKFSR*
Ga0099793_1029695923300007258Vadose Zone SoilMVDADHVAAAAGGDASLFLAIPALWIVGVIVLVALKFHSR*
Ga0099793_1037698213300007258Vadose Zone SoilMLVIGVDHAAPAADGDALLLLAIPVLWIVGVVVLVAFKFRSR*
Ga0066710_10005317933300009012Grasslands SoilMLVMGADHVAAATGGEAVLILAMPVLWILGVIVFVAIKLRSR
Ga0066710_10184727923300009012Grasslands SoilVIGADHVAAAAGADAILFLAIAALWIVGVVIFVAFKLHSR
Ga0066710_10215880723300009012Grasslands SoilIGADHVAAAGGADAILFLAIPVIWIIGVIVFVAFKFHSR
Ga0099827_1006259133300009090Vadose Zone SoilMLLIGADHVAAAAGGDAMLFLAIPVLWIIGVIVFVAFKFRSR*
Ga0099827_1123340623300009090Vadose Zone SoilMLVMGTDHVTAASGSEAMLLVATPLLWIVGVIVFVAFKLRSR*
Ga0066709_10005644453300009137Grasslands SoilMLVMGADHVAAATGGEAVLILAMPVLWILGVIVFVAIKLRSR*
Ga0066709_10039445833300009137Grasslands SoilMMGADHVAAAAGGEAILILAIPVLWILGVIAFVALKLRSR*
Ga0066709_10172968923300009137Grasslands SoilMLVVGADHVAAAVGGDAILLLAIPVTWIIGVIVFVAFKFHSR*
Ga0066709_10273188223300009137Grasslands SoilMLVIGADHVAAAAGADAILFLAIAALWIVGVVVFVAFKLHSR*
Ga0134080_1044867823300010333Grasslands SoilMLMIGADHVTAAAGADAILFLAIPVIWIIGVIVIVAFKFHSR*
Ga0134063_1018981533300010335Grasslands SoilMLVMGADDVVAAAGDEAILILAIQVLWILGVIVFVALKLRSR*
Ga0134063_1024375813300010335Grasslands SoilHVVAAAGDEAILILAIPVLWILGVIVSVALKLRSR*
Ga0134125_1137734723300010371Terrestrial SoilMLVMGADHVAAAAGGDAITLLLVPLLWMLGVIVFVAFKLHSR*
Ga0134128_1137054623300010373Terrestrial SoilMLVIGADHVAAAAGPDAIALLLVPLLWILGVIVFVAFKLHFR*
Ga0137391_1102801623300011270Vadose Zone SoilMLVIGPDHVAAAAGADAVVLLAIPVVWVVGVIVFVAFKLRAR*
Ga0137364_1111601313300012198Vadose Zone SoilMLVIGADHVASATGADAILLLAIPVLWIIGVIVFVALKFHSR*
Ga0137399_1013365323300012203Vadose Zone SoilMVDADHVAAAAGGEVLLLLAIPALWIVGVIVLVALKFHSR*
Ga0137380_1017859313300012206Vadose Zone SoilDAMLVIGADHVAAVGGVDAILLLAIPVLWVVGVVVCVAFKLRAR*
Ga0137381_1053108233300012207Vadose Zone SoilMLVIGPDHVASAAGADAIVLLAIPVLWIVGVVLFVVFKFHRR*
Ga0137377_1106485623300012211Vadose Zone SoilMLVIGADHVAAAGGADAILFLAIPVIWIIGVIVFVAFKFHSR*
Ga0137377_1143346323300012211Vadose Zone SoilMLVMGADHVAAAAGGEAILILAIPVLWILGVIAFVALKLRSR*
Ga0137375_1092420423300012360Vadose Zone SoilMLVISADHVAAVAGSDAILFLAIPVLWIAGVVLLIAFKFRSR*
Ga0137390_1035582923300012363Vadose Zone SoilMLVIGADHVAAAAGVDAIVLLAIPVLWVVGVIVFVAFKLRTR*
Ga0137397_1004002013300012685Vadose Zone SoilMFVIGADHVATAIGADAVLLLAIPVLWIIGVIVFVVFKLHSR*
Ga0137397_1061157323300012685Vadose Zone SoilMLVIGADHVAAATGADAVLLLAIPVLWMIGVIVIVAFKFLSR*
Ga0137396_1045823323300012918Vadose Zone SoilMLVIGTDHVAAATGADAVLLLAIPVLWIIGVVILVAFKFHAR*
Ga0137394_1031737923300012922Vadose Zone SoilMLVIGADHVAAAAGGDALLLLAVPVLWIIGVVILVAIKFHAR*
Ga0137394_1080707523300012922Vadose Zone SoilMFVIGADHVATAIGADAVLLLAIPVLWMIGVIVLVAFKLHSR*
Ga0137394_1082346623300012922Vadose Zone SoilMLVIGADHIAAASGGDAILFLVIPVLWMIGVIVFVAFKFHSR*
Ga0137419_1004230053300012925Vadose Zone SoilMLVIGTDHVAAAAGADAVLLLAIPVLWIIGVIVFVAFKFHSR*
Ga0137416_1021291233300012927Vadose Zone SoilMLVIGTDHVAAAAGADAVLLLAIPVLWIIGVIVFVAFKFSR*
Ga0137410_1004691953300012944Vadose Zone SoilMLVIGADHVATAIGADAILLLAIPVLWIIGVIVFVAFKFSR*
Ga0134087_1023263523300012977Grasslands SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVICSVALKLRSR*
Ga0137409_1005675853300015245Vadose Zone SoilMLVISADHVAAATGADVVLLLAIPVLWIIGVIVFVAFKFSR*
Ga0137409_1082802813300015245Vadose Zone SoilTMLSIAADHVAAAAGGDALLLAIPVLWIIGVVILVAFKFRSR*
Ga0134074_115914523300017657Grasslands SoilMLVIGTDHVVAAAGDEAILILAMPVLWILGVIAFVALKLRSR
Ga0134074_135472613300017657Grasslands SoilMLMIGADHVAAAAGADAILFLAIPVIWIIGVIVIVAFKFHSR
Ga0184605_1000196043300018027Groundwater SedimentMFMIGADHVAAATGADAILLLAIPVLWIIGVIVFVAFKFHSR
Ga0184605_1001349053300018027Groundwater SedimentMLVIGADHVATAIGGDAILFLAIPVLWMIGIIVLVAFKFHSR
Ga0184608_1000155553300018028Groundwater SedimentMLVIGADHVATAIGGDAILFLAIPVLWMIGVIVLVAFKFHSR
Ga0184608_1047840513300018028Groundwater SedimentMFVIGADHVAAASGNDAILFLAIPVLWIIGVIVFVAFKFRTR
Ga0184621_1032479523300018054Groundwater SedimentMLVIGADHVATAIGGDAILLLAIPVLWMIGVIVLVAFKFHSR
Ga0184618_1007543333300018071Groundwater SedimentMFMIGADHVAAATGADAILLLAIPVLWIIGVIVFVAFKFR
Ga0066655_1045091823300018431Grasslands SoilMLVMGADHVVAAAGDEAILILAMPVLWILGVIVSVALKLRSR
Ga0066667_1002520933300018433Grasslands SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVIVSVALKLRSR
Ga0184643_107482223300019255Groundwater SedimentMGADHVATAIGGDAILFLAIPVLWMIGVIVLVAFKFHSR
Ga0193723_102294323300019879SoilMLVIGADHVAAVAGTDAIVLLAIPLLWIAGVIAFVAFKLRSR
Ga0193735_118255323300020006SoilMLVIGADHVAAVAGTDAIVLLAIPLLWIAGVIGFV
Ga0193734_105441313300020015SoilADHVAAVTGGDAMLLLAIPVAWILGVIVFVAVKLHSR
Ga0210382_1000966423300021080Groundwater SedimentMLVMGADHVATAIGGDAILFLAIPVLWMIGVIVLVAFKFHSR
Ga0222622_1024569823300022756Groundwater SedimentMLVIGADHVAAASGNDAILFLAIPVLWIIGVIVFVAFKFRTR
Ga0193714_100277343300023058SoilMLVIGADHIAAAAGGDAIALLLVPVLWILGVIVFVALKLHSR
Ga0207684_1018085833300025910Corn, Switchgrass And Miscanthus RhizosphereMPAIGADHVAAASGGDAILLLAIPVLWMIGVVVFVAFKFHSR
Ga0207684_1073544623300025910Corn, Switchgrass And Miscanthus RhizosphereMLVIGADHIAAASGGDAILLLAIPVLWMIGVIVFVAFKFHSR
Ga0209238_117527713300026301Grasslands SoilMLVIGADHVAASAGGDALLLLAIPVLWIIGVVILVAFKFRAR
Ga0209239_124580923300026310Grasslands SoilMLVMGADHVAAAAGGEAILILAMPVLWILGVIAFVALKLRSR
Ga0209761_114328723300026313Grasslands SoilMLVIGADHVAAAADGDALLLLAIPVLWIVGVVVLVAFKFRTR
Ga0209803_101725113300026332SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVIVIVALKLRSR
Ga0209808_103055453300026523SoilMLVIGTDHVVAAAGDEAILILAIPVLWILGVIVSVALK
Ga0209058_103134923300026536SoilMMLVMAADHVAAAVGGDALFLLAIPVLWLIGVVLLIAFKFRSR
Ga0209590_1039206133300027882Vadose Zone SoilMMLLIGADHVAAAAGGDAMLFLAIPVLWIIGVIVFVAFKFRSR
Ga0137415_1011062523300028536Vadose Zone SoilMLVIGTDHVAAAAGADAVLLLAIPVLWIIGVIVFVAFKFHSR
Ga0307287_1008363413300028796SoilTFMFVIGADHVAAASGNDAILFLAIPVLWIIGVIVFVAFKFRTR
Ga0307292_1029360823300028811SoilIIGADHVAAASSGEVMFLLAIPVLWIVGVIVFVAFKFHSR
Ga0307302_1033274123300028814SoilRVSILTLMLVIGADHVAAASGNDAILFLAIPVLWIIGVIVFVAFKFRTR
Ga0307312_1081318413300028828SoilMRQYTDIMLVIGADHVAAAAGGDALLLLAIPVLWIVG
Ga0307277_1000178393300028881SoilMLVIGADHIAAASGGDAILFLAIPVLWMIGVIVFVAFKFHSR
Ga0307469_1014844923300031720Hardwood Forest SoilMLVIGADHVASAAGADAIVLLAVPVLWIVGVVLFVAFKLHRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.