NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097092

Metagenome Family F097092

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097092
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence RRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 95.19 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.885 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil
(10.577 % of family members)
Environment Ontology (ENVO) Unclassified
(31.731 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.192 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.29%    β-sheet: 0.00%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01790LGT 77.88
PF03466LysR_substrate 11.54
PF03547Mem_trans 4.81
PF13098Thioredoxin_2 2.88
PF13183Fer4_8 1.92
PF02754CCG 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 77.88
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 4.81
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.96
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.88 %
All OrganismsrootAll Organisms47.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10258361Not Available547Open in IMG/M
3300001686|C688J18823_10791988All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria602Open in IMG/M
3300003996|Ga0055467_10094444All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300004024|Ga0055436_10147856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria715Open in IMG/M
3300004153|Ga0063455_100845057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales641Open in IMG/M
3300004157|Ga0062590_101118627All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300004157|Ga0062590_101952650All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae607Open in IMG/M
3300004480|Ga0062592_101428254All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300004643|Ga0062591_102935557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales506Open in IMG/M
3300005171|Ga0066677_10076861All Organisms → cellular organisms → Bacteria → Proteobacteria1727Open in IMG/M
3300005178|Ga0066688_10941325Not Available530Open in IMG/M
3300005328|Ga0070676_10426168All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300005334|Ga0068869_101624918All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300005343|Ga0070687_100242246All Organisms → cellular organisms → Bacteria → Proteobacteria1116Open in IMG/M
3300005345|Ga0070692_10523029All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales773Open in IMG/M
3300005441|Ga0070700_101603065All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria556Open in IMG/M
3300005444|Ga0070694_101076916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae670Open in IMG/M
3300005549|Ga0070704_101587674All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005577|Ga0068857_100970581All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300005713|Ga0066905_101516001Not Available611Open in IMG/M
3300006755|Ga0079222_10530985Not Available873Open in IMG/M
3300006847|Ga0075431_100563205All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1126Open in IMG/M
3300006852|Ga0075433_10229768All Organisms → cellular organisms → Bacteria → Proteobacteria1647Open in IMG/M
3300006876|Ga0079217_10040197All Organisms → cellular organisms → Bacteria → Proteobacteria1815Open in IMG/M
3300006876|Ga0079217_11621818All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria517Open in IMG/M
3300006876|Ga0079217_11634674Not Available516Open in IMG/M
3300006894|Ga0079215_10685608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales689Open in IMG/M
3300006904|Ga0075424_101238435Not Available794Open in IMG/M
3300007004|Ga0079218_10279258All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300007004|Ga0079218_11997285All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009089|Ga0099828_11921216Not Available519Open in IMG/M
3300009094|Ga0111539_10520001All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1386Open in IMG/M
3300009147|Ga0114129_10105260All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. WDL13899Open in IMG/M
3300009147|Ga0114129_13264880Not Available526Open in IMG/M
3300009148|Ga0105243_10026640All Organisms → cellular organisms → Bacteria → Proteobacteria4426Open in IMG/M
3300009609|Ga0105347_1227938Not Available758Open in IMG/M
3300009609|Ga0105347_1536428Not Available509Open in IMG/M
3300010337|Ga0134062_10367445All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria697Open in IMG/M
3300010397|Ga0134124_10217295All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1744Open in IMG/M
3300010397|Ga0134124_11388097All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300010397|Ga0134124_12262960Not Available584Open in IMG/M
3300010401|Ga0134121_12763416Not Available536Open in IMG/M
3300010401|Ga0134121_12777249Not Available535Open in IMG/M
3300010403|Ga0134123_12258386Not Available607Open in IMG/M
3300010403|Ga0134123_12516807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300011400|Ga0137312_1008049All Organisms → cellular organisms → Bacteria → Proteobacteria1263Open in IMG/M
3300011402|Ga0137356_1043205Not Available842Open in IMG/M
3300011410|Ga0137440_1076260Not Available669Open in IMG/M
3300012179|Ga0137334_1127410Not Available576Open in IMG/M
3300012206|Ga0137380_10254002All Organisms → cellular organisms → Bacteria → Proteobacteria1584Open in IMG/M
3300012362|Ga0137361_11318500Not Available646Open in IMG/M
3300012469|Ga0150984_112396399Not Available677Open in IMG/M
3300012922|Ga0137394_10673490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria872Open in IMG/M
3300012948|Ga0126375_11468018Not Available581Open in IMG/M
3300012960|Ga0164301_10716819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria755Open in IMG/M
3300013297|Ga0157378_12778352Not Available542Open in IMG/M
3300014150|Ga0134081_10303011Not Available574Open in IMG/M
3300014157|Ga0134078_10355534Not Available645Open in IMG/M
3300014269|Ga0075302_1010937All Organisms → cellular organisms → Bacteria → Proteobacteria1515Open in IMG/M
3300015054|Ga0137420_1296146Not Available677Open in IMG/M
3300015248|Ga0180079_1049687Not Available615Open in IMG/M
3300015358|Ga0134089_10010221All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3011Open in IMG/M
3300017930|Ga0187825_10333892Not Available571Open in IMG/M
3300017965|Ga0190266_10502019Not Available707Open in IMG/M
3300018083|Ga0184628_10244204Not Available942Open in IMG/M
3300018431|Ga0066655_10921999Not Available598Open in IMG/M
3300018469|Ga0190270_11376576All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria751Open in IMG/M
3300020202|Ga0196964_10083815All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300020202|Ga0196964_10702320Not Available501Open in IMG/M
3300020215|Ga0196963_10480443Not Available562Open in IMG/M
3300021080|Ga0210382_10244706All Organisms → cellular organisms → Bacteria → Proteobacteria784Open in IMG/M
3300024246|Ga0247680_1044133Not Available646Open in IMG/M
3300024286|Ga0247687_1048824Not Available633Open in IMG/M
3300025535|Ga0207423_1020448All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300025604|Ga0207930_1119995Not Available586Open in IMG/M
3300025711|Ga0207696_1192773Not Available536Open in IMG/M
3300025893|Ga0207682_10091269All Organisms → cellular organisms → Bacteria → Proteobacteria1320Open in IMG/M
3300025901|Ga0207688_10030570All Organisms → cellular organisms → Bacteria → Proteobacteria2971Open in IMG/M
3300025903|Ga0207680_10021872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3469Open in IMG/M
3300025907|Ga0207645_10186563All Organisms → cellular organisms → Bacteria → Proteobacteria1362Open in IMG/M
3300025936|Ga0207670_10483498All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300026041|Ga0207639_10398139All Organisms → cellular organisms → Bacteria → Proteobacteria1240Open in IMG/M
3300026052|Ga0208289_1004300All Organisms → cellular organisms → Bacteria → Proteobacteria1068Open in IMG/M
3300026535|Ga0256867_10168145Not Available814Open in IMG/M
3300027513|Ga0208685_1134211Not Available529Open in IMG/M
3300027639|Ga0209387_1127925Not Available647Open in IMG/M
3300027695|Ga0209966_1077750Not Available733Open in IMG/M
3300027775|Ga0209177_10229829Not Available675Open in IMG/M
3300027775|Ga0209177_10486848Not Available512Open in IMG/M
3300027821|Ga0209811_10232264Not Available701Open in IMG/M
3300027886|Ga0209486_10894087Not Available588Open in IMG/M
3300027964|Ga0256864_1066662Not Available992Open in IMG/M
3300028145|Ga0247663_1080741Not Available578Open in IMG/M
3300028802|Ga0307503_10911457Not Available509Open in IMG/M
3300028812|Ga0247825_11364611Not Available519Open in IMG/M
3300031184|Ga0307499_10199829Not Available614Open in IMG/M
3300031716|Ga0310813_11296151Not Available673Open in IMG/M
3300031720|Ga0307469_10441526All Organisms → cellular organisms → Bacteria → Proteobacteria1124Open in IMG/M
3300031820|Ga0307473_11496087Not Available512Open in IMG/M
3300031913|Ga0310891_10306454Not Available561Open in IMG/M
3300032002|Ga0307416_103275189Not Available542Open in IMG/M
3300032144|Ga0315910_11164599Not Available602Open in IMG/M
3300033417|Ga0214471_11514252Not Available502Open in IMG/M
3300034819|Ga0373958_0060903Not Available817Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil10.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026052Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027964Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeqEnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1025836123300001305SoilEIADAHPRLELWLAWRRGEVGVAARELISQARRLSA*
C688J18823_1079198813300001686SoilGRRGVVYRALADRHPRLELWLAWRRGSLSAAGQEFVAHARRLAA*
Ga0055467_1009444413300003996Natural And Restored WetlandsGVVYRELADVHPRLDLWLAWPRSGLGAAARDFLALARRRNR*
Ga0055436_1014785613300004024Natural And Restored WetlandsVPASVANLGRRGVVYRDIADAHPKLDLWLAWRRGAQGMAAREFVQHARRLAR*
Ga0063455_10084505723300004153SoilANLGRRGVVYRELADAHPRLDLWLAWRRGDLGAAARDFLAHARRIAR*
Ga0062590_10111862713300004157SoilVSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV*
Ga0062590_10195265023300004157SoilPGSVANLGRRGVVYRRISDRHPVLELWLAWRAGATSAAAAEFVALARSLAKA*
Ga0062592_10142825423300004480SoilPASIANLGRRGVAYREIADAHPRLDLWLAWRSGALGAAAREFVLHARRIAR*
Ga0062591_10293555723300004643SoilGAAIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNEGGTAGLGAAARDFLALARQRAR*
Ga0066677_1007686133300005171SoilGAAIVPASVANLGRRGVAYRELAERHPRLDLWLAWCRGALDAAGREFVAHARRLV*
Ga0066688_1094132513300005178SoilRGVVYRELAERHPRLDLWLAWRRGVLDAPGHEFVALARTLAP*
Ga0070676_1042616823300005328Miscanthus RhizosphereRRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA*
Ga0068869_10162491813300005334Miscanthus RhizosphereGSLANLGRRGVVYRRLSDRHPMLELWLAWRRGATGAAAEEFIAQARSLAKA*
Ga0070687_10024224613300005343Switchgrass RhizosphereANLGRRGVVYRELADPHPKLDLWLAWPRNEGGTAGLGTAARDFLALARQRTR*
Ga0070692_1052302923300005345Corn, Switchgrass And Miscanthus RhizosphereAIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNEGGTAGLGTAARDFLALARQRTR*
Ga0070700_10160306513300005441Corn, Switchgrass And Miscanthus RhizosphereACLANLGRRGVVYREIADPHPRLDLWLAWRRGALAFPGGGAAREFVAQARRLSKESR*
Ga0070694_10107691623300005444Corn, Switchgrass And Miscanthus RhizosphereVVYRALADRHPRLDVWLAWRRGSLSAASQEFVAHARRIAA*
Ga0070704_10158767423300005549Corn, Switchgrass And Miscanthus RhizosphereSIANLGRRGVVYRELADRHPRLDLWLAWRRGSLAAPAREFVSLARELAA*
Ga0068857_10097058123300005577Corn RhizosphereVPDSLANLGRRGVVYRKLADRHPTLELWLAWRRGSAGTALLEFIAQAQRLAKA*
Ga0066905_10151600123300005713Tropical Forest SoilRRGVVYRELADRHPRLDVWLAWPRGPLGAAARDFVAHARELRRK*
Ga0079222_1053098513300006755Agricultural SoilYRALADRHPRLDVWLAWRRGSLSAASQEFVAYARRIAA*
Ga0075431_10056320513300006847Populus RhizosphereYRELADRHPRLDLWLAWPRGALSAAARDFVTHARRYV*
Ga0075433_1022976813300006852Populus RhizosphereVANLGRRGVVYRELADRHPRLDVWLAWRRGVPDAAGKEFIALARSLAA*
Ga0079217_1004019733300006876Agricultural SoilRGVTYREIADAHPRLDLWLAWRRGALGAAGRDFVTHARRIAR*
Ga0079217_1162181823300006876Agricultural SoilRGVVYREIADPHPRLDLWLAWRRGALGATARDFLVHARRAAR*
Ga0079217_1163467423300006876Agricultural SoilVYREINDRHPRLDLWLAWPRGALGTVARDFLALARRRAR*
Ga0079215_1068560833300006894Agricultural SoilMAKLGRRGVVYRDIGDAHPRLDVWLAWPRGPLSVAAQQFVDLAR*
Ga0075424_10123843523300006904Populus RhizosphereLADRHPRLDLWLAWPRGALSAAARDFVTHARRGA*
Ga0079218_1027925813300007004Agricultural SoilLVPASLANLGRRGVRYRELKDAHPRLDLWLAWRRGTLGAAGREFLLHARRIAS*
Ga0079218_1199728523300007004Agricultural SoilAKLGRRGVVYRDIGDAHPRLDVWLAWPRGPLSVAAQQFVELAR*
Ga0099828_1192121623300009089Vadose Zone SoilLADRHPRLDLWLAWRRGMLDAPGREFVALARSLAP*
Ga0111539_1052000113300009094Populus RhizosphereRRGVAYREIADAHPRLDLWLAWRRGAVASVAAREFIQHARRVAR*
Ga0114129_1010526043300009147Populus RhizosphereDRHPRLELWLAWRRGPGGPTAGSAGRDFIAQARRLAE*
Ga0114129_1326488023300009147Populus RhizosphereIANLGRRGVVYRSLADRHPRLDLWLAWRRAPLSEAALQFVAHARRLAA*
Ga0105243_1002664043300009148Miscanthus RhizosphereAIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNGLGTAARDFLALARQRAR*
Ga0105347_122793823300009609SoilANLGRRGVLYRELADRHPRLDLWLAWPRGALAAAARDFVAHARRIAS*
Ga0105347_153642823300009609SoilRRGVAYREIADPHPRLDLWLAWRRGTQGVAAREFVQHARRVAR*
Ga0134062_1036744513300010337Grasslands SoilAAIVPASVANLGRRGVVYRELADRHPRLDVWLAWRRGVPDAAGKEFIALARSLAA*
Ga0134124_1021729513300010397Terrestrial SoilELADAHPRLDLWLAWRRGTATGVAAREFLQHARRLAR*
Ga0134124_1138809713300010397Terrestrial SoilLADAHPSLDLWLAWRRGPLGVAAREFMQHARRISR*
Ga0134124_1226296023300010397Terrestrial SoilYRELADAHPRLDLWLAWRRGAAAGVAAREFLQHARRLAR*
Ga0134121_1276341623300010401Terrestrial SoilALVPASLANLGRRGVVYRELADPHPRLDVRLAWRKGLFGSVHGVAAREFVLHARRIAR*
Ga0134121_1277724913300010401Terrestrial SoilNLGRRGVAYRELADAHPRLDLWLAWLRGSVGATAGIAAREFLQHARRLAR*
Ga0134123_1225838623300010403Terrestrial SoilPASVANLGRRGVVYRELAGRHPRLDLWLAWPRGTLVAAARDFVAHARRTRR*
Ga0134123_1251680713300010403Terrestrial SoilAVVPGSVANLARRGVVYRRISDRHPMLELWLAWRVGTPSAAAAEFIALARSLAKA*
Ga0137312_100804913300011400SoilRELADAHPRLDLWLAWRRGALGATARDFLLHARRGAR*
Ga0137356_104320523300011402SoilNLGRRGVVYRELADRHPRLDLWLAWPRGALAAAARDFVAHARRIAS*
Ga0137440_107626013300011410SoilEIADAHPKLDLWLAWRRGAVGTTAGVAAREFVQHARRIAR*
Ga0137334_112741023300012179SoilVYRELADAHPRLDLWLAWRRGALGATARDFLAHARRGAR*
Ga0137380_1025400213300012206Vadose Zone SoilNLGRRGVVYRELADPHPRLDLWLAWRRGASGATAGAAGREFVAHARRLAR*
Ga0137361_1131850013300012362Vadose Zone SoilIAEPHPRLDLWLAWRRGALGVAGREFAAQARRLAR*
Ga0150984_11239639923300012469Avena Fatua RhizosphereREISDPHPRLELWLAWRRGELGIAARELIAQARRLSG*
Ga0137394_1067349013300012922Vadose Zone SoilAAIVPASVANLGRRGVAYRELADRHPRLDVWLAWRKKVPDAAGREFISLARSLAA*
Ga0126375_1146801823300012948Tropical Forest SoilELADRHPRLDLWLAWRRGALSAAARDFVTHARRRA*
Ga0164301_1071681923300012960SoilPASVSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV*
Ga0157378_1277835213300013297Miscanthus RhizosphereIADPHPRLELWLGWRRGELGAAARELVAQAKRLAA*
Ga0134081_1030301123300014150Grasslands SoilVYREIAEPHPRLDLWLAWRRGALGAAGREFAAQARRLAR*
Ga0134078_1035553423300014157Grasslands SoilEIADPHPRLELWLAWRRGELGVAARELITQARRLSG*
Ga0075302_101093733300014269Natural And Restored WetlandsASVANLGRRGVTYREIADAHPRLDLWLAWRRGVFGSVHGAAARDFIQHARRLAR*
Ga0137420_129614613300015054Vadose Zone SoilVAYREIADPHPRLDLWLAWRRGALGAAGREFAAQARRLAR*
Ga0180079_104968713300015248SoilIADAHPRLDLWLAWRGGALGAAAREFVLHARRIAR*
Ga0134089_1001022113300015358Grasslands SoilLGRRGVAYREIADPHPRLDLWLAWRRGALGAAGREFAAQARRLAR*
Ga0187825_1033389223300017930Freshwater SedimentLAERHPRLDLWLGWPRAAGSGLGAAARDFLALARGLSR
Ga0190266_1050201913300017965SoilNLGRRGVAYREIADAHPRLDLWLAWRSGPLGAAAREFVLHARRIAR
Ga0184628_1024420423300018083Groundwater SedimentYREIADAHPKLDLWLAWRRSTVGTTAGVAAREFVQHARRLTR
Ga0066655_1092199923300018431Grasslands SoilSEIAESHPRLDVWLAWRRGTMSPVQREFVALARREDR
Ga0190270_1137657623300018469SoilRRGVVYREINDRHPRLDLWLAWPRGGLGTAARDFLALARRGR
Ga0196964_1008381513300020202SoilGCMAKLGRRGVVYREISDPHPRLDLWLAWPRGGLGIAAAQFVGLAR
Ga0196964_1070232013300020202SoilSVANLGRRGVAYRELADRHPRLDLWLAWPRGSLGAPGHDFVAHARRLAP
Ga0196963_1048044323300020215SoilEIAEAHPRLDLWLAWPRGTPGAAAHDFIALARGGR
Ga0210382_1024470613300021080Groundwater SedimentGRSGVTYRDLADRHPRLDLWLAWPRGALGAAGRDFVAHARQIAR
Ga0247680_104413313300024246SoilVAYRELADRHPRLDLWLAWPRGTLSAAARDFVAHARRSGQ
Ga0247687_104882413300024286SoilASVSNLGRRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA
Ga0207423_102044813300025535Natural And Restored WetlandsAYRELADRHPRLDVWLAWPRGALGAAARDFVARARELRP
Ga0207930_111999523300025604Arctic Peat SoilYRELADGHPRLDLWLAWRRGALGVPGGTAGRDFVRHARRMAGQSR
Ga0207696_119277323300025711Switchgrass RhizosphereLGRRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA
Ga0207682_1009126913300025893Miscanthus RhizospherePHPKLDLWLAWPRNQGGAAGLGTAARDFLALARRRAR
Ga0207688_1003057013300025901Corn, Switchgrass And Miscanthus RhizosphereIANLGRRGVVYRELADPHPKLDLWLAWPRNQDGAAGLGTAARDFLALARRRAR
Ga0207680_1002187233300025903Switchgrass RhizosphereRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA
Ga0207645_1018656313300025907Miscanthus RhizosphereGAAIVPGSIANLGRRGVVYRELADPHPKLDLWLAWPRNQGGAAGLGTAARDFLALARRRA
Ga0207670_1048349833300025936Switchgrass RhizosphereRELADRHPRLDLWLAWPRGTLSAAARDFVAHARRSGQ
Ga0207639_1039813913300026041Corn RhizosphereYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA
Ga0208289_100430013300026052Natural And Restored WetlandsEIADAHPRLDLWLAWRRGGLGAAAREFVLHARRLAR
Ga0256867_1016814523300026535SoilIGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR
Ga0208685_113421123300027513SoilVPASVANLGRRGVVYREIADAHPRLDLWLAWRRGSLGAAGREFVQHARRIAR
Ga0209387_112792523300027639Agricultural SoilIADAHPRLDLWLAWRRGALGAAGRDFLTHARRIAR
Ga0209966_107775023300027695Arabidopsis Thaliana RhizosphereNLGRRGVAYREIADAHPRLDLWLAWRRGGLGAAGREFVQHARRIAR
Ga0209177_1022982913300027775Agricultural SoilDPHPKLDLWLAWRRGPGGIIAGAAGREFVIHAKRLAR
Ga0209177_1048684813300027775Agricultural SoilSVANLGRRGVVYRELRDAHPRLDVWLAWPRATLEPAAQEFVALARRLAP
Ga0209811_1023226413300027821Surface SoilASVSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV
Ga0209486_1089408713300027886Agricultural SoilLVPASLANLGRRGVRYRELKDAHPRLDLWLAWRRGTLGAAGREFLLHARRIAS
Ga0256864_106666213300027964SoilRDIGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR
Ga0247663_108074123300028145SoilVVPGSVANLARRGVVYRRISDRHPMLELWLAWRVGTPSAAAAEFIALARSLEKA
Ga0307503_1091145723300028802SoilSGVVYRELADAHPRLDLWLAWRRGELGATARDFLAHARRRTR
Ga0247825_1136461123300028812SoilVVPACMAKLGRRGVVYREIADAHPRLDLWLAWPGGALGVAAQQFADLARKP
Ga0307499_1019982923300031184SoilAYRELADPHPKLDLWLAWRRGPLGVAARDFVQHARRLI
Ga0310813_1129615113300031716SoilANLGRRGVVYREISDPHPKLDLWLAWRRGPGGITAGAAGREFVIHAKRLAR
Ga0307469_1044152613300031720Hardwood Forest SoilGVVYRELADAHPRLDLWLAWPRGALSAAGREFLAHARRSGH
Ga0307473_1149608723300031820Hardwood Forest SoilGRRGVVYRELADRHSRLDLWLAWRRGALDAPAREFVALARELAP
Ga0310891_1030645413300031913SoilNLGRRGVVYRALAERHPRLDLWLAWRRGALAQPAAEFVALARRLAQ
Ga0307416_10327518923300032002RhizosphereVPASIANLGRRGVVYREIADAHPRLDLWLAWRRGGLGASARDFLACARRNAR
Ga0315910_1116459923300032144SoilRGVVYREIGDPHPRLDLWLAWRRGELGATARDFLAQARRGTR
Ga0214471_1151425223300033417SoilYRDIGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR
Ga0373958_0060903_704_8173300034819Rhizosphere SoilYSELADRHPRLDLWLAWPRGARSAAARDFVTHARRGA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.