NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097094

Metagenome / Metatranscriptome Family F097094

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097094
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 40 residues
Representative Sequence VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP
Number of Associated Samples 85
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.65 %
% of genes near scaffold ends (potentially truncated) 20.19 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.154 % of family members)
Environment Ontology (ENVO) Unclassified
(37.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.731 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.41%    β-sheet: 0.00%    Coil/Unstructured: 45.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13419HAD_2 55.88
PF07690MFS_1 12.75
PF13242Hydrolase_like 8.82
PF00076RRM_1 7.84
PF13893RRM_5 0.98
PF00857Isochorismatase 0.98
PF00982Glyco_transf_20 0.98
PF00578AhpC-TSA 0.98
PF13490zf-HC2 0.98
PF02518HATPase_c 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.98
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.98
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.19 %
UnclassifiedrootN/A4.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002908|JGI25382J43887_10039805All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2555Open in IMG/M
3300003203|JGI25406J46586_10030887All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300005166|Ga0066674_10076224All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300005166|Ga0066674_10187764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium982Open in IMG/M
3300005167|Ga0066672_10093730All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300005175|Ga0066673_10054079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2035Open in IMG/M
3300005186|Ga0066676_10040011All Organisms → cellular organisms → Bacteria2609Open in IMG/M
3300005332|Ga0066388_100167590All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300005332|Ga0066388_101368346All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300005332|Ga0066388_102681870All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium909Open in IMG/M
3300005332|Ga0066388_105123298All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium665Open in IMG/M
3300005406|Ga0070703_10041255All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300005445|Ga0070708_101132043All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300005451|Ga0066681_10647806All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005536|Ga0070697_100546162All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300005552|Ga0066701_10304641All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300005560|Ga0066670_10094648All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300005566|Ga0066693_10232391All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium726Open in IMG/M
3300005569|Ga0066705_10553889Not Available712Open in IMG/M
3300005764|Ga0066903_100325251All Organisms → cellular organisms → Bacteria2460Open in IMG/M
3300005764|Ga0066903_106697996All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium599Open in IMG/M
3300005937|Ga0081455_10479341All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium842Open in IMG/M
3300006049|Ga0075417_10028316All Organisms → cellular organisms → Bacteria2301Open in IMG/M
3300006049|Ga0075417_10059715All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300006755|Ga0079222_10451370All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300006794|Ga0066658_10686801Not Available564Open in IMG/M
3300006800|Ga0066660_10363384All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300006806|Ga0079220_11915915All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006844|Ga0075428_100010843All Organisms → cellular organisms → Bacteria10129Open in IMG/M
3300006845|Ga0075421_102138239All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300006854|Ga0075425_100753552All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300006854|Ga0075425_102622267All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300007255|Ga0099791_10075587All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1531Open in IMG/M
3300007255|Ga0099791_10206126All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium927Open in IMG/M
3300007265|Ga0099794_10138146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1233Open in IMG/M
3300007265|Ga0099794_10138146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1233Open in IMG/M
3300007265|Ga0099794_10162747All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300009012|Ga0066710_100874315All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300009100|Ga0075418_10447617Not Available1384Open in IMG/M
3300009137|Ga0066709_103687040All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300009147|Ga0114129_10764989All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300009792|Ga0126374_11196004Not Available608Open in IMG/M
3300010043|Ga0126380_11011030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium701Open in IMG/M
3300010046|Ga0126384_11267121All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium682Open in IMG/M
3300010046|Ga0126384_11441519All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium643Open in IMG/M
3300010046|Ga0126384_12023500All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300010047|Ga0126382_12292622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300010140|Ga0127456_1256077All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300010329|Ga0134111_10119162All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300010359|Ga0126376_10355321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1301Open in IMG/M
3300010362|Ga0126377_12410263All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium602Open in IMG/M
3300012189|Ga0137388_11384630All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300012198|Ga0137364_10304261All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1184Open in IMG/M
3300012203|Ga0137399_10353815All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300012349|Ga0137387_10028065All Organisms → cellular organisms → Bacteria3602Open in IMG/M
3300012362|Ga0137361_10530093All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300012393|Ga0134052_1316739All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium531Open in IMG/M
3300012410|Ga0134060_1130387Not Available575Open in IMG/M
3300012918|Ga0137396_10097581All Organisms → cellular organisms → Bacteria2093Open in IMG/M
3300012918|Ga0137396_10451744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium953Open in IMG/M
3300012918|Ga0137396_10451744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium953Open in IMG/M
3300012925|Ga0137419_10668412All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300012927|Ga0137416_11816277All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300012944|Ga0137410_10427271All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300012948|Ga0126375_10944772All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium697Open in IMG/M
3300012976|Ga0134076_10013672All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2805Open in IMG/M
3300015241|Ga0137418_10751576All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium739Open in IMG/M
3300015371|Ga0132258_10936447All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300015372|Ga0132256_102844049All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300017659|Ga0134083_10010420All Organisms → cellular organisms → Bacteria3106Open in IMG/M
3300017659|Ga0134083_10131714All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300018431|Ga0066655_10003521All Organisms → cellular organisms → Bacteria6124Open in IMG/M
3300018431|Ga0066655_10034240All Organisms → cellular organisms → Bacteria2503Open in IMG/M
3300018468|Ga0066662_10441021All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300018482|Ga0066669_12346199All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300019789|Ga0137408_1296361All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1299Open in IMG/M
3300020170|Ga0179594_10087548All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300024330|Ga0137417_1100550All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300025939|Ga0207665_10061128All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2553Open in IMG/M
3300026277|Ga0209350_1049085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1226Open in IMG/M
3300026295|Ga0209234_1080463All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300026297|Ga0209237_1026214All Organisms → cellular organisms → Bacteria3249Open in IMG/M
3300026297|Ga0209237_1110613All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1182Open in IMG/M
3300026297|Ga0209237_1188387All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300026300|Ga0209027_1016960All Organisms → cellular organisms → Bacteria2760Open in IMG/M
3300026301|Ga0209238_1014608All Organisms → cellular organisms → Bacteria3040Open in IMG/M
3300026324|Ga0209470_1042661All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300026536|Ga0209058_1035756All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2997Open in IMG/M
3300026540|Ga0209376_1055778All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300026542|Ga0209805_1007408All Organisms → cellular organisms → Bacteria6011Open in IMG/M
3300026547|Ga0209156_10228731All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300026548|Ga0209161_10306727All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium759Open in IMG/M
3300026552|Ga0209577_10122919All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300027209|Ga0209875_1026054All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium696Open in IMG/M
3300027655|Ga0209388_1089146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium886Open in IMG/M
3300027671|Ga0209588_1115493All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium861Open in IMG/M
3300027765|Ga0209073_10087404All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1083Open in IMG/M
3300027775|Ga0209177_10010482All Organisms → cellular organisms → Bacteria2061Open in IMG/M
3300027873|Ga0209814_10009049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3900Open in IMG/M
3300027873|Ga0209814_10047719All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300027880|Ga0209481_10257260All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium880Open in IMG/M
3300031716|Ga0310813_10460107All Organisms → cellular organisms → Bacteria → Proteobacteria1105Open in IMG/M
3300031720|Ga0307469_11532293All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300032180|Ga0307471_100998559All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1004Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil13.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25382J43887_1003980533300002908Grasslands SoilMRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP*
JGI25406J46586_1003088723300003203Tabebuia Heterophylla RhizosphereMKLARLAIWLATAGFIVMLFYPLVVELLMRFGSHGDSGLP*
Ga0066674_1007622423300005166SoilVKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP*
Ga0066674_1018776423300005166SoilMRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0066672_1009373033300005167SoilVKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066673_1005407923300005175SoilVKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066676_1004001133300005186SoilVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0066388_10016759023300005332Tropical Forest SoilVKLARLAIWIATAGFVVMLFYPLVMEIIVRIGSRGDSGVP*
Ga0066388_10136834613300005332Tropical Forest SoilAPDVRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP*
Ga0066388_10268187023300005332Tropical Forest SoilMRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADTTLP*
Ga0066388_10512329813300005332Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIFLRFGSHGDSGLP*
Ga0070703_1004125523300005406Corn, Switchgrass And Miscanthus RhizosphereVRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP*
Ga0070708_10113204323300005445Corn, Switchgrass And Miscanthus RhizosphereVKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066681_1064780623300005451SoilMRLARLAIWLATAAFVVMLFYPLVREILVRIGGRGDSGLP*
Ga0070697_10054616223300005536Corn, Switchgrass And Miscanthus RhizosphereVKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP*
Ga0066701_1030464123300005552SoilVKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP*
Ga0066670_1009464813300005560SoilVKLARFGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066693_1023239123300005566SoilVKLARLGIWIATGVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066705_1055388923300005569SoilLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066903_10032525123300005764Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIFVRFGPHADSGLP*
Ga0066903_10669799623300005764Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP*
Ga0081455_1047934123300005937Tabebuia Heterophylla RhizosphereVRLARLAIWLATASFVFMLFYPLVMEILARIGSRADSGLP*
Ga0075417_1002831623300006049Populus RhizosphereMKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP*
Ga0075417_1005971533300006049Populus RhizosphereVRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP*
Ga0079222_1045137013300006755Agricultural SoilVKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP*
Ga0066658_1068680123300006794SoilAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP*
Ga0066660_1036338423300006800SoilVKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP*
Ga0079220_1191591523300006806Agricultural SoilVRLARAAIWIATAIFVLMLFYPLVTEMLARLAVRGDSGLP*
Ga0075428_100010843103300006844Populus RhizosphereVRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP*
Ga0075421_10213823923300006845Populus RhizosphereVRLARLAIWIATAGFIFMLFYPLLMEIFARLGTHADSGLP*
Ga0075425_10075355223300006854Populus RhizosphereVRLARLAIWLATASFVFMLFYPLVVELLMRFGPQADSGLP*
Ga0075425_10262226723300006854Populus RhizosphereVRLARLAIWFATAGFVFMLFYPLVMEIFARFGTHADSVLP*
Ga0099791_1007558723300007255Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099791_1020612613300007255Vadose Zone SoilVKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0099794_1013814633300007265Vadose Zone SoilVKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099794_1013814643300007265Vadose Zone SoilGAARVKLTRLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099794_1016274723300007265Vadose Zone SoilVRLVRLAIWVATAGFVLMLFYPLVMELLTQLAARGDTGLP*
Ga0066710_10087431533300009012Grasslands SoilVKLERLGIWIATAVFLVMPFYPLVMEIPARAAARGDSVLP
Ga0075418_1044761733300009100Populus RhizosphereARMKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP*
Ga0066709_10368704013300009137Grasslands SoilVKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDS
Ga0114129_1076498923300009147Populus RhizosphereVKLARLAIWVATAGFVFMLFYPLVMEILARIAARGESGVP*
Ga0126374_1119600413300009792Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADNGLP*
Ga0126380_1101103013300010043Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIIVRIGSRADSGLP*
Ga0126384_1126712123300010046Tropical Forest SoilVRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRADSGLP*
Ga0126384_1144151913300010046Tropical Forest SoilVRLTRLAIWIATAGFVFMLFYPLVMEIFARFGNHADTGLP*
Ga0126384_1202350023300010046Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIVVRFGTHADTALP*
Ga0126382_1229262213300010047Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIIVRIASRSDSGVP*
Ga0127456_125607723300010140Grasslands SoilMRVARLAIWVATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0134111_1011916233300010329Grasslands SoilVKLARFAIWVATASFVLMLFYPLVMEILARVSARGESVLP*
Ga0126376_1035532123300010359Tropical Forest SoilVRLARLAIWIATAGFIFMLFYPLVMEIFVRFGTHADSGLP*
Ga0126377_1241026323300010362Tropical Forest SoilVRLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSGLP*
Ga0137388_1138463023300012189Vadose Zone SoilVKLARLGIWIATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0137364_1030426123300012198Vadose Zone SoilVRLVRLAIWIATAGFVVMLFYPLVREILARIAGQGESGLP*
Ga0137399_1035381533300012203Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILARLSARGESVLP*
Ga0137387_1002806563300012349Vadose Zone SoilMRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP*
Ga0137361_1053009333300012362Vadose Zone SoilVKLARLGIWVATAVFVVMLFYPLVMEILARSAARGDSVLP*
Ga0134052_131673933300012393Grasslands SoilAVGAARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0134060_113038713300012410Grasslands SoilAARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0137396_1009758133300012918Vadose Zone SoilVRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP
Ga0137396_1045174423300012918Vadose Zone SoilVRLARLAIWIATATFVVMLFYPLVMEILARISARGESGLP*
Ga0137396_1045174433300012918Vadose Zone SoilRLARLAIWIATAGFVVMLFYPLVMEILARLSARGESVLP*
Ga0137419_1066841223300012925Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILARISARGESGLP*
Ga0137416_1181627713300012927Vadose Zone SoilVKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSV
Ga0137410_1042727133300012944Vadose Zone SoilVRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP*
Ga0126375_1094477213300012948Tropical Forest SoilVRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRGDSGVP*
Ga0134076_1001367263300012976Grasslands SoilRLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP*
Ga0137418_1075157623300015241Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILVRVAARGDS
Ga0132258_1093644713300015371Arabidopsis RhizosphereVKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP*
Ga0132256_10284404923300015372Arabidopsis RhizosphereVRLARLAIWIATAGFVFMLFYPLVMEIFVRFAPHADSGLP*
Ga0134083_1001042023300017659Grasslands SoilVKLARFAIWVATASFVFMLFYPLVTEILARVAARGESGLP
Ga0134083_1013171423300017659Grasslands SoilMRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP
Ga0066655_1000352133300018431Grasslands SoilMRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0066655_1003424053300018431Grasslands SoilVKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP
Ga0066662_1044102113300018468Grasslands SoilVKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0066669_1234619913300018482Grasslands SoilVKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP
Ga0137408_129636133300019789Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP
Ga0179594_1008754833300020170Vadose Zone SoilVRLARLAIWIATASFVVMLFYPLVMEILARAAARGDSVLP
Ga0137417_110055033300024330Vadose Zone SoilVKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP
Ga0207665_1006112813300025939Corn, Switchgrass And Miscanthus RhizosphereHPVALGAAHVKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP
Ga0209350_104908533300026277Grasslands SoilGAARMRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0209234_108046313300026295Grasslands SoilVKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSV
Ga0209237_102621433300026297Grasslands SoilVRLVRLAIWVATAGFVLMLFYPLVMELLVQFAARGDTGLP
Ga0209237_111061333300026297Grasslands SoilMRFARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0209237_118838713300026297Grasslands SoilMRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP
Ga0209027_101696033300026300Grasslands SoilVKLARFGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP
Ga0209238_101460813300026301Grasslands SoilVKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0209470_104266123300026324SoilVRLARLAIWVATASFVFMLFYPLVTEILARVAARGESGLP
Ga0209058_103575613300026536SoilVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP
Ga0209376_105577833300026540SoilVKLARFAIWVATASFVFMLFYPLVMEIVTRIAARGDSGLP
Ga0209805_100740813300026542SoilARVKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP
Ga0209156_1022873123300026547SoilVKLARFAIWVATASFVFMLFYPLVMEILTRIAARG
Ga0209161_1030672713300026548SoilVKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGL
Ga0209577_1012291933300026552SoilVKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGRP
Ga0209875_102605423300027209Groundwater SandVRLARLAIWIATASFIVMLFYPLVMEILARVTSRGGSGLP
Ga0209388_108914623300027655Vadose Zone SoilVKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP
Ga0209588_111549323300027671Vadose Zone SoilVKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0209073_1008740413300027765Agricultural SoilVKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP
Ga0209177_1001048233300027775Agricultural SoilVKLARVAIWIATAAFVVMLFYPLVREILARLGLHGESGLP
Ga0209814_1000904913300027873Populus RhizosphereMKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP
Ga0209814_1004771913300027873Populus RhizosphereVRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP
Ga0209481_1025726023300027880Populus RhizosphereVRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP
Ga0310813_1046010723300031716SoilVKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP
Ga0307469_1153229313300031720Hardwood Forest SoilVKLVRLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP
Ga0307471_10099855923300032180Hardwood Forest SoilVRLVRLVIWLATAGFVFLLFYPLVMEALLRLRSRGDGSFP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.